5Z6R: Spastin aaa with ATP

Spastin aaa with ATP. Determined by X-ray diffraction at 3.0 Å resolution. Released 30 Jan 2019.

Method: X-ray diffraction
Resolution: 3.0 Å
Organism: Homo sapiens
Chains: 1
Atoms: 2,022
Mol. weight: 43.25 kDa
Ligands: ATP
Released: 30 Jan 2019

Explore 5Z6R in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

5Z6R contains 24 α-helices and 6 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 24 helices, 6 β-strands

Element	Residues	Length	Sheet
α-helix	326-330	5
β-strand	333	1	1
α-helix	338-340	3
α-helix	341-343	3
α-helix	348-354	7
α-helix	355-359	5
α-helix	360-363	4
α-helix	370-372	3
α-helix	373-375	3
β-strand	377-381	5	1
α-helix	388-398	11
β-strand	402-407	6	1
α-helix	425-432	8
β-strand	436-441	6	1
α-helix	443-446	4
α-helix	461-473	13
β-strand	480-486	7	1
α-helix	489-491	3
α-helix	494-499	6
β-strand	502-505	4	1
α-helix	507-509	3
α-helix	511-523	13
α-helix	531-540	10
α-helix	546-556	11
α-helix	559-563	5
α-helix	566-570	5
α-helix	574-576	3
α-helix	578-580	3
α-helix	582-591	10
α-helix	598-609	12

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Spastin	A	protein	392	Homo sapiens	Q9UBP0 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>5Z6R_1 Spastin (chains A)
GPGSSGAVPKRKDPLTHTSNSLPRSKTVMKTGSAGLSGHHRAPSYSGLSMVSGVKQGSGP
APTTHKGTPKTNRTNKPSTPTTATRKKKDLKNFRNVDSNLANLIMNEIVDNGTAVKFDDI
AGQDLAKQALQEIVILPSLRPELFTGLRAPARGLLLFGPPGNGKTMLAKAVAAESNATFF
NISAASLTSKYVGEGEKLVRALFAVARELQPSIIFIDQVDSLLCERREGEHDASRRLKTE
FLIEFDGVQSAGDDRVLVMGATNRPQELDEAVLRRFIKRVYVSLPNEETRLLLLKNLLCK
QGSPLTQKELAQLARMTDGYSGSDLTALAKDAALGPIRELKPEQVKNMSASEMRNIRLSD
FTESLKKIKRSVSPQTLEAYIRWNKDFGDTTV

Ligands and cofactors

ID	Name	Formula	Copies
ATP	Adenosine-5'-triphosphate	C10 H16 N5 O13 P3	1

Primary citation

The Aaa Family Protein Spastin Severs A Microtubule. Lin, Z., Wang, C., Shen, Y. To be published.

Other PDB entries of the same protein (UniProt Q9UBP0 (AlphaFold model), which also has an AlphaFold model), best resolution first:

7S7J 1.15 Å, Structure of Human SPASTIN-IST1 complex.
3EAB 2.5 Å, Crystal structure of Spastin MIT in complex with ESCRT III
5Z6Q 3.0 Å, Crystal structure of AAA of Spastin
3VFD 3.3 Å, Human spastin AAA domain
6PEK 4.2 Å, Structure of Spastin Hexamer (Subunit A-E) in complex with substrate peptide
6PEN 4.2 Å, Structure of Spastin Hexamer (whole model) in complex with substrate peptide

Browse structure collections

About this viewer

MolViewer shows 5Z6R directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.