3VFD: Human spastin AAA domain

Human spastin AAA domain. Determined by X-ray diffraction at 3.3 Å resolution. Released 30 May 2012.

Method: X-ray diffraction
Resolution: 3.3 Å
Organism: Homo sapiens
Chains: 1
Atoms: 2,068
Mol. weight: 42.67 kDa
Released: 30 May 2012

Explore 3VFD in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

3VFD contains 20 α-helices and 6 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 20 helices, 6 β-strands

Element	Residues	Length	Sheet
α-helix	328-330	3
β-strand	333	1	1
α-helix	338-340	3
α-helix	341-343	3
α-helix	348-354	7
α-helix	355-359	5
α-helix	360-363	4
α-helix	370-372	3
α-helix	373-375	3
β-strand	377-381	5	1
α-helix	388-398	11
β-strand	402-406	5	1
α-helix	420-432	13
β-strand	436-441	6	1
α-helix	443-446	4
α-helix	458-472	15
β-strand	481-487	7	1
α-helix	490-492	3
α-helix	495-498	4
β-strand	503-506	4	1
α-helix	512-523	12
α-helix	532-541	10
α-helix	547-557	11
α-helix	560-563	4
α-helix	583-592	10
α-helix	599-611	13

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Spastin	A	protein	389	Homo sapiens	Q9UBP0 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>3VFD_1 Spastin (chains A)
ESGAVPKRKDPLTHTSNSLPRSKTVMKTGSAGLSGHHRAPSYSGLSMVSGVKQGSGPAPT
THKGTPKTNRTNKPSTPTTATRKKKDLKNFRNVDSNLANLIMNEIVDNGTAVKFDDIAGQ
DLAKQALQEIVILPSLRPELFTGLRAPARGLLLFGPPGNGKTMLAKAVAAESNATFFNIS
AASLTSKYVGEGEKLVRALFAVARELQPSIIFIDQVDSLLCERREGEHDASRRLKTEFLI
EFDGVQSAGDDRVLVMGATNRPQELDEAVLRRFIKRVYVSLPNEETRLLLLKNLLCKQGS
PLTQKELAQLARMTDGYSGSDLTALAKDAALGPIRELKPEQVKNMSASEMRNIRLSDFTE
SLKKIKRSVSPQTLEAYIRWNKDFGDTTV

Primary citation

Crystal structure of the human spastin AAA domain. Taylor, J.L., White, S.R., Lauring, B. et al. J Struct Biol (2012) 179:133-137. DOI 10.1016/j.jsb.2012.03.002 · PubMed

Other PDB entries of the same protein (UniProt Q9UBP0 (AlphaFold model), which also has an AlphaFold model), best resolution first:

7S7J 1.15 Å, Structure of Human SPASTIN-IST1 complex.
3EAB 2.5 Å, Crystal structure of Spastin MIT in complex with ESCRT III
5Z6Q 3.0 Å, Crystal structure of AAA of Spastin
5Z6R 3.0 Å, Spastin aaa with ATP
6PEK 4.2 Å, Structure of Spastin Hexamer (Subunit A-E) in complex with substrate peptide
6PEN 4.2 Å, Structure of Spastin Hexamer (whole model) in complex with substrate peptide

Browse structure collections

About this viewer

MolViewer shows 3VFD directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.