3EB3: Voltage-dependent K+ channel beta subunit

Voltage-dependent K+ channel beta subunit (W121A) in complex with cortisone. Determined by X-ray diffraction at 2.0 Å resolution. Released 23 Sept 2008.

Method: X-ray diffraction
Resolution: 2.0 Å
Organism: Rattus norvegicus
Chains: 1
Atoms: 2,757
Mol. weight: 37.56 kDa
Ligands: PDN, NDP
Released: 23 Sept 2008

Explore 3EB3 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

3EB3 contains 22 α-helices and 14 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 22 helices, 14 β-strands

Element	Residues	Length	Sheet
β-strand	39-41	3	1
β-strand	48-50	3	1
β-strand	52-55	4	2
α-helix	59-63	5
α-helix	66-78	13
β-strand	83-85	3	2
α-helix	90-93	4
α-helix	94-106	13
α-helix	110-112	3
β-strand	114-119	6	2
β-strand	121	1	3
α-helix	126-128	3
β-strand	129	1	3
α-helix	133-147	15
β-strand	152-157	6	2
α-helix	166-178	13
β-strand	182-188	7	2
α-helix	192-204	13
α-helix	208-210	3
β-strand	212-216	5	2
β-strand	218	1	4
β-strand	221	1	4
α-helix	223	1
α-helix	224-228	5
α-helix	229-236	8
β-strand	239-243	5	2
α-helix	247-252	6
α-helix	264-266	3
α-helix	271-278	8
α-helix	280-299	20
α-helix	303-312	10
β-strand	317-322	6	2
α-helix	327-334	8
α-helix	335-338	4
α-helix	340-342	3
α-helix	345-355	11

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Voltage-gated potassium channel subunit beta-2	A	protein	327	Rattus norvegicus	P62483 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>3EB3_1 Voltage-gated potassium channel subunit beta-2 (chains A)
MLQFYRNLGKSGLRVSCLGLGTWVTFGGQITDEMAEHLMTLAYDNGINLFDTAEVYAAGK
AEVVLGNIIKKKGWRRSSLVITTKIFAGGKAETERGLSRKHIIEGLKASLERLQLEYVDV
VFANRPDPNTPMEETVRAMTHVINQGMAMYWGTSRWSSMEIMEAYSVARQFNLIPPICEQ
AEYHMFQREKVEVQLPELFHKIGVGAMTWSPLACGIVSGKYDSGIPPYSRASLKGYQWLK
DKILSEEGRRQQAKLKELQAIAERLGCTLPQLAIAWCLRNEGVSSVLLGASNAEQLMENI
GAIQVLPKLSSSIVHEIDSILGNKPYS

Ligands and cofactors

ID	Name	Formula	Copies
PDN	17,21-dihydroxypregna-1,4-diene-3,11,20-trione	C21 H26 O5	1
NDP	NADPH dihydro-nicotinamide-adenine-dinucleotide phosphate	C21 H30 N7 O17 P3	1

Primary citation

Cortisone dissociates the Shaker family K+ channels from their beta subunits. Pan, Y., Weng, J., Kabaleeswaran, V. et al. Nat Chem Biol (2008) 4:708-714. DOI 10.1038/nchembio.114 · PubMed

Other PDB entries of the same protein (UniProt P62483 (AlphaFold model), which also has an AlphaFold model), best resolution first:

3EAU 1.82 Å, Voltage-dependent K+ channel beta subunit in complex with cortisone
3EB4 2.0 Å, Voltage-dependent K+ channel beta subunit (I211R) in complex with cortisone
1EXB 2.1 Å, Structure of the cytoplasmic beta subunit-T1 assembly of voltage-dependent K channels
2R9R 2.4 Å, Shaker family voltage dependent potassium channel (kv1.2-kv2.1 paddle chimera channel)…
4JTA 2.5 Å, Crystal structure of Kv1.2-2.1 paddle chimera channel in complex with Charybdotoxin
4JTD 2.54 Å, Crystal structure of Kv1.2-2.1 paddle chimera channel in complex with Lys27Met mutant of…
4JTC 2.56 Å, Crystal structure of Kv1.2-2.1 paddle chimera channel in complex with Charybdotoxin in Cs+
1QRQ 2.8 Å, Structure of a voltage-dependent K+ channel beta subunit
2A79 2.9 Å, Mammalian Shaker Kv1.2 potassium channel- beta subunit complex
3LNM 2.9 Å, F233W mutant of the Kv2.1 paddle-Kv1.2 chimera channel
3LUT 2.9 Å, A Structural Model for the Full-length Shaker Potassium Channel Kv1.2
6EBL 3.0 Å, The voltage-activated Kv1.2-2.1 paddle chimera channel in lipid nanodiscs, cytosolic…

Browse structure collections

About this viewer

MolViewer shows 3EB3 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.