3EOX: High quality structure of cleaved PAI-1-stab

High quality structure of cleaved PAI-1-stab. Determined by X-ray diffraction at 2.61 Å resolution. Released 17 Feb 2009.

Method: X-ray diffraction
Resolution: 2.61 Å
Organism: Homo sapiens
Chains: 1
Atoms: 3,084
Mol. weight: 42.75 kDa
Released: 17 Feb 2009

Explore 3EOX in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

3EOX contains 14 α-helices and 17 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 14 helices, 17 β-strands

Element	Residues	Length	Sheet
α-helix	3-26	24
β-strand	32-34	3	1
α-helix	36-49	14
α-helix	52-62	11
α-helix	71-83	13
α-helix	85-87	3
β-strand	90-100	11	2
α-helix	105-106	2
α-helix	109-114	6
β-strand	122-124	3	2
α-helix	129-142	14
β-strand	163-174	12	2
β-strand	175	1	3
α-helix	178-180	3
α-helix	181-183	3
β-strand	185-190	6	1
β-strand	196-214	19	1
β-strand	220-227	8	1
β-strand	228	1	3
β-strand	233-240	8	1
α-helix	248-251	4
α-helix	256-264	9
β-strand	267-276	10	1
β-strand	278-285	8	2
α-helix	287-292	6
α-helix	297-299	3
β-strand	319-328	10	2
β-strand	332-342	11	2
β-strand	352-353	2	1
β-strand	358-364	7	1
β-strand	369-376	8	1

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Plasminogen activator inhibitor 1	A	protein	379	Homo sapiens	P05121 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>3EOX_1 Plasminogen activator inhibitor 1 (chains A)
VHHPPSYVAHLASDFGVRVFQQVAQASKDRNVVFSPYGVASVLAMLQLTTGGETQQQIQA
AMGFKIDDKGMAPALRHLYKELMGPWNKDEISTTDAIFVQRDLKLVQGFMPHFFRLFRST
VKQVDFSEVERARFIINDWVKTHTKGMISHLLGTGAVDQLTRLVLVNALYFNGQWKTPFP
DSSTHRRLFHKSDGSTVSVPMMAQTNKFNYTEFTTPDGHYYDILELPYHGDTLSMFIAAP
YEKEVPLSALTNILSAQLISHWKGNMTRLPRLLVLPKFSLETEVDLRKPLENLGMTDMFR
PFQADFTSLSDQEPLHVALALQKVKIEVNESGTVASSSTAVIVSARMAPEEIIIDRPFLF
VVRHNPTGTVLFMGQVMEP

Primary citation

High quality structure of cleaved PAI-1-stab. Dewilde, M., Strelkov, S.V., Rabijns, A. et al. J Struct Biol (2009) 165:126-132. DOI 10.1016/j.jsb.2008.11.001 · PubMed

Other PDB entries of the same protein (UniProt P05121 (AlphaFold model), which also has an AlphaFold model), best resolution first:

7AQF 1.77 Å, Crystal Structure of Small Molecule Inhibitor TM5484 Bound to Stabilized Active…
1LJ5 1.8 Å, 1.8A Resolution Structure of Latent Plasminogen Activator Inhibitor-1(PAI-1)
6ZRV 1.88 Å, Crystal Structure of Stabilized Active Plasminogen Activator Inhibitor-1 (PAI-1-W175F)…
1A7C 1.95 Å, Human plasminogen activator inhibitor type-1 in complex with a pentapeptide
3CVM 2.02 Å, High resolution structure of a stable Plasminogen activator inhibitor type-1 in its…
6GWN 2.03 Å, Crystal Structure of Stabilized Active Plasminogen Activator Inhibitor-1 (PAI-1-W175F)…
1DVN 2.1 Å, Latent form of plasminogen activator inhibitor-1 (pai-1)
4G8R 2.19 Å, Crystal Structure of a novel small molecule inactivator bound to plasminogen activator…
7AQG 2.27 Å, Crystal Structure of Small Molecule Inhibitor TM5484 Bound to Stabilized Active…
1OC0 2.28 Å, plasminogen activator inhibitor-1 complex with somatomedin B domain of vitronectin
6GWP 2.28 Å, Crystal Structure of Stabilized Active Plasminogen Activator Inhibitor-1 (PAI-1-stab) in…
3PB1 2.3 Å, Crystal Structure of a Michaelis Complex between Plasminogen Activator Inhibitor-1 and…

Browse structure collections

About this viewer

MolViewer shows 3EOX directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.