3FFD: Monoclonal antibody, heavy chain, Fab fragment

Structure of parathyroid hormone-related protein complexed to a neutralizing monoclonal antibody. Determined by X-ray diffraction at 2.0 Å resolution. Released 28 Apr 2009.

Method: X-ray diffraction
Resolution: 2.0 Å
Organisms: Mus musculus, Homo sapiens
Chains: 3
Atoms: 3,595
Mol. weight: 59.69 kDa
Released: 28 Apr 2009

Explore 3FFD in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

3FFD contains 17 α-helices and 44 β-strands across 3 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 9 helices, 22 β-strands

Element	Residues	Length	Sheet
β-strand	3-7	5	1
β-strand	11-12	2	2
β-strand	18-25	8	1
α-helix	29-31	3
β-strand	34-39	6	3
β-strand	45-51	7	3
β-strand	58-59	2	3
β-strand	68-73	6	1
α-helix	74-76	3
β-strand	78-83	6	1
α-helix	88-90	3
β-strand	92-98	7	3
β-strand	107-108	2	3
β-strand	112-114	3	3
β-strand	115-116	2	2
α-helix	120-121	2
β-strand	122	1	4
α-helix	123-124	2
β-strand	125-129	5	5
β-strand	141-150	10	5
β-strand	151	1	4
β-strand	156-159	4	6
α-helix	160-162	3
β-strand	169-170	2	5
α-helix	171-173	3
β-strand	174-176	3	5
β-strand	179-188	10	5
α-helix	192-195	4
β-strand	199-204	6	6
α-helix	205-207	3
β-strand	209-214	6	6

Chain B: 7 helices, 22 β-strands

Element	Residues	Length	Sheet
β-strand	4-5	2	7
β-strand	9-13	5	8
β-strand	18-24	7	7
α-helix	26-28	3
β-strand	33-38	6	8
β-strand	45-50	6	8
β-strand	56-58	3	8
α-helix	59	1
β-strand	66-71	6	7
β-strand	74-79	6	7
α-helix	84-86	3
β-strand	88-98	11	8
β-strand	101-106	6	8
β-strand	110-115	6	8
α-helix	117-119	3
β-strand	120	1	9
α-helix	121-122	2
β-strand	123-127	5	10
α-helix	131-134	4
β-strand	138-148	11	10
β-strand	149	1	9
β-strand	154-159	6	11
β-strand	162-164	3	11
β-strand	168-170	3	10
β-strand	174-176	3	10
β-strand	179-189	11	10
α-helix	190-194	5
β-strand	199-205	7	11
β-strand	208-214	7	11

Chain P: 1 helix, 0 β-strands

Element	Residues	Length	Sheet
α-helix	15-29	15

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Monoclonal antibody, heavy chain, Fab fragment	A	protein	218	Mus musculus
Monoclonal antibody, light chain, Fab fragment	B	protein	220	Mus musculus
Parathyroid hormone-related protein	P	protein	108	Homo sapiens	P12272 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>3FFD_1 Monoclonal antibody, heavy chain, Fab fragment (chains A)
EVQLVESGGDLVKPGGSLKLSCAASGFTFSSYGMSWIRQTPDKRLEWVATISSGGSYTYY
PDSVKGRFTISRDNAKNTLYLQMSSLKSEDTAMFYCARQTTMTYFAYWGQGTLVTVSAAK
TTPPSVYPLAPGSAAQTNSMVTLGCLVKGYFPEPVTVTWNSGSLSSGVHTFPAVLQSDLY
TLSSSVTVPSSPRPSETVTCNVAHPASSTKVDKKIEPA

Sequence of entity 2 (B), FASTA

>3FFD_2 Monoclonal antibody, light chain, Fab fragment (chains B)
QLVLTQSSSASFSLGASAKLTCTLSSQHSTYTIEWYQQQPLKPPKYVMDLKQDGSHSTGD
GIPDRFSGSSSGADRYLSISNIQPEDEAMYICGVGDTIKEQFVYVFGGGTKVTVLGEPKS
TPTLTVFPPSSEELKENKATLVCLISNFSPSGVTVAWKANGTPITQGVDTSNPTKEGNKF
MASSFLHLTSDQWRSHNSFTCQVTHEGDTVEKSLSPAECL

Sequence of entity 3 (P), FASTA

>3FFD_3 Parathyroid hormone-related protein (chains P)
AVSEHQLLHDKGKSIQDLRRRFFLHHLIAEIHTAEIRATSEVSPNSKPSPNTKNHPVRFG
SDDEGRYLTQETNKVETYKEQPLKTPGKKKKGKPGKRKEQEKKKRRTR

Primary citation

Structural basis for antibody discrimination between two hormones that recognize the parathyroid hormone receptor. McKinstry, W.J., Polekhina, G., Diefenbach-Jagger, H. et al. J Biol Chem (2009) 284:15557-15563. DOI 10.1074/jbc.M900044200 · PubMed

Other PDB entries of the same protein (UniProt P12272 (AlphaFold model), which also has an AlphaFold model), best resolution first:

7UZO 1.3 Å, Parathyroid hormone 1 receptor extracellular domain complexed with a peptide ligand…
3H3G 1.94 Å, Crystal structure of the extracellular domain of the human parathyroid hormone receptor…
8D51 2.0 Å, Parathyroid hormone 1 receptor extracellular domain complexed with a peptide ligand…
8D52 2.02 Å, Parathyroid hormone 1 receptor extracellular domain complexed with a peptide ligand…
7UZP 2.29 Å, parathyroid hormone 1 receptor extracellular domain complexed with a peptide ligand…
1M5N 2.9 Å, Crystal structure of HEAT repeats (1-11) of importin b bound to the non-classical…
8FLR 2.94 Å, Human PTH1R in complex with PTHrP and Gs
7VVJ 3.2 Å, PTHrP-bound human PTH1R in complex with Gs
8HAF 3.25 Å, PTHrP-PTH1R-Gs complex
1BZG The solution structure of human parathyroid hormone-related protein (1-34) in…

Browse structure collections

About this viewer

MolViewer shows 3FFD directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.