7UZO: PDB entry 7UZO

Parathyroid hormone 1 receptor extracellular domain complexed with a peptide ligand containing one beta-amino acid. Determined by X-ray diffraction at 1.3 Å resolution. Released 19 Oct 2022.

Method: X-ray diffraction
Resolution: 1.3 Å
Organism: Homo sapiens
Chains: 2
Atoms: 1,220
Mol. weight: 14.67 kDa
Ligands: ZN
Released: 19 Oct 2022

Explore 7UZO in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

7UZO contains 7 α-helices and 11 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 6 helices, 11 β-strands

Element	Residues	Length	Sheet
α-helix	31-33	3
α-helix	34-55	22
α-helix	63	1
β-strand	64	1	1
α-helix	65-66	2
β-strand	67-68	2	2
β-strand	73-74	2	2
β-strand	77	1	1
β-strand	82-86	5	3
α-helix	87-88	2
β-strand	99-103	5	3
β-strand	104	1	4
β-strand	110	1	4
β-strand	112-113	2	5
β-strand	118-119	2	5
β-strand	122	1	3
α-helix	124-127	4

Chain B: 1 helix, 0 β-strands

Element	Residues	Length	Sheet
α-helix	16-31	16

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Parathyroid hormone/parathyroid hormone-related peptide receptor	A	protein	101	Homo sapiens	Q03431 (AlphaFold model)
Peptide from Parathyroid hormone-related protein	B	protein	23	Homo sapiens	P12272 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>7UZO_1 Parathyroid hormone/parathyroid hormone-related peptide receptor (chains A)
DVMTKEEQIFLLHRAQAQCEKRLKEVLQRPAGRPCLPEWDHILCWPLGAPGEVVAVPCPD
YIYDFNHKGHAYRRCDRNGSWELVPGHNRTWANYSECVKFL

Sequence of entity 2 (B), FASTA

>7UZO_2 Peptide from Parathyroid hormone-related protein (chains B)
YQDLRRRFFLHHLIAEXHTAEIX

Ligands and cofactors

ID	Name	Formula	Copies
ZN	Zinc ion	Zn	1

Primary citation

Altered signaling at the PTH receptor via modified agonist contacts with the extracellular domain provides a path to prolonged agonism in vivo. Liu, S., Yu, Z., Daley, E.J. et al. Proc Natl Acad Sci U S A (2022) 119:e2212736119-e2212736119. DOI 10.1073/pnas.2212736119 · PubMed

Other PDB entries of the same protein (UniProt Q03431 (AlphaFold model), which also has an AlphaFold model), best resolution first:

5EMB 0.85 Å, Crystal structure of the SNX27 PDZ domain bound to the C-terminal phosphorylated PTHR…
4Z8J 0.95 Å, Crystal structure of the SNX27 PDZ domain bound to the C-terminal PTHR PDZ binding motif
3H3G 1.94 Å, Crystal structure of the extracellular domain of the human parathyroid hormone receptor…
3C4M 1.95 Å, Structure of human parathyroid hormone in complex with the extracellular domain of its…
8D51 2.0 Å, Parathyroid hormone 1 receptor extracellular domain complexed with a peptide ligand…
8D52 2.02 Å, Parathyroid hormone 1 receptor extracellular domain complexed with a peptide ligand…
7UZP 2.29 Å, parathyroid hormone 1 receptor extracellular domain complexed with a peptide ligand…
8BIA 2.4 Å, Crystal structure of Scribble PDZ1 with PTHR
6FJ3 2.5 Å, High resolution crystal structure of parathyroid hormone 1 receptor in complex with a…
8FLQ 2.55 Å, Human PTH1R in complex with PTH(1-34) and Gs
8JR9 2.57 Å, Small molecule agonist (PCO371) bound to human parathyroid hormone receptor type 1 (PTH1R)
8YG4 2.59 Å, A cryo-EM structure of LA-PTH-R1-PTH1R-Gs complex structure

Browse structure collections

About this viewer

MolViewer shows 7UZO directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.