Parathyroid hormone 1 receptor extracellular domain complexed with a peptide ligand containing beta-3-homotryptophan. Determined by X-ray diffraction at 2.0 Å resolution. Released 14 Jun 2023.
Explore 8D51 in 3D Show helices and sheets RCSB PDB PDBe
8D51 contains 6 α-helices and 10 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 34-57 | 24 | |
| β-strand | 108 | 1 | 1 |
| α-helix | 109-110 | 2 | |
| β-strand | 111-112 | 2 | 2 |
| β-strand | 117-118 | 2 | 2 |
| β-strand | 121 | 1 | 1 |
| β-strand | 125-130 | 6 | 3 |
| α-helix | 131-132 | 2 | |
| β-strand | 143-148 | 6 | 3 |
| β-strand | 154 | 1 | 3 |
| α-helix | 155 | 1 | |
| β-strand | 156 | 1 | 4 |
| α-helix | 157 | 1 | |
| β-strand | 163 | 1 | 4 |
| β-strand | 165-166 | 2 | 3 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 17-31 | 15 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Parathyroid hormone/parathyroid hormone-related peptide receptor | A | protein | 103 | Homo sapiens | Q03431 (AlphaFold model) |
| PTHrP[1-36] | B | protein | 22 | Homo sapiens | P12272 (AlphaFold model) |
>8D51_1 Parathyroid hormone/parathyroid hormone-related peptide receptor (chains A) GDDVMTKEEQIFLLHRAQAQCEKRLKEVLQRPAGRPCLPEWDHILCWPLGAPGEVVAVPC PDYIYDFNHKGHAYRRCDRNGSWELVPGHNRTWANYSECVKFL
>8D51_2 PTHrP[1-36] (chains B) IQDLRRRFFLHHLIAEWHTAEI
| ID | Name | Formula | Copies |
|---|---|---|---|
| ZN | Zinc ion | Zn | 1 |
Water and common crystallization additives (EDO) are not listed.
Harnessing Aromatic-Histidine Interactions through Synergistic Backbone Extension and Side Chain Modification. Yu, Z., Kreitler, D.F., Chiu, Y.T.T. et al. Angew Chem Int Ed Engl (2023) 62:e202308100-e202308100. DOI 10.1002/anie.202308100 · PubMed
Other PDB entries of the same protein (UniProt Q03431 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 8D51 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.