8D52: PDB entry 8D52

Parathyroid hormone 1 receptor extracellular domain complexed with a peptide ligand containing (2-naphthyl)-beta-3-homoalanine. Determined by X-ray diffraction at 2.02 Å resolution. Released 14 Jun 2023.

Method: X-ray diffraction
Resolution: 2.02 Å
Organism: Homo sapiens
Chains: 2
Atoms: 1,028
Mol. weight: 14.96 kDa
Ligands: ZN
Released: 14 Jun 2023

Explore 8D52 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

8D52 contains 9 α-helices and 10 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 8 helices, 10 β-strands

Element	Residues	Length	Sheet
α-helix	34-57	24
α-helix	107	1
β-strand	108	1	1
α-helix	109-110	2
β-strand	111-112	2	2
β-strand	117-118	2	2
α-helix	120	1
β-strand	121	1	1
α-helix	122	1
β-strand	125-130	6	3
α-helix	131-132	2
β-strand	143-148	6	3
β-strand	154	1	3
α-helix	155	1
β-strand	156	1	4
α-helix	157	1
β-strand	163	1	4
β-strand	165-166	2	3

Chain B: 1 helix, 0 β-strands

Element	Residues	Length	Sheet
α-helix	18-31	14

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Parathyroid hormone/parathyroid hormone-related peptide receptor	A	protein	103	Homo sapiens	Q03431 (AlphaFold model)
PTHrP[1-36]	B	protein	22	Homo sapiens	P12272 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>8D52_1 Parathyroid hormone/parathyroid hormone-related peptide receptor (chains A)
GDDVMTKEEQIFLLHRAQAQCEKRLKEVLQRPAGRPCLPEWDHILCWPLGAPGEVVAVPC
PDYIYDFNHKGHAYRRCDRNGSWELVPGHNRTWANYSECVKFL

Sequence of entity 2 (B), FASTA

>8D52_2 PTHrP[1-36] (chains B)
IQDLRRRFFLHHLIAEXHTAEI

Ligands and cofactors

ID	Name	Formula	Copies
ZN	Zinc ion	Zn	1

Water and common crystallization additives (EDO) are not listed.

Primary citation

Harnessing Aromatic-Histidine Interactions through Synergistic Backbone Extension and Side Chain Modification. Yu, Z., Kreitler, D.F., Chiu, Y.T.T. et al. Angew Chem Int Ed Engl (2023) 62:e202308100-e202308100. DOI 10.1002/anie.202308100 · PubMed

Other PDB entries of the same protein (UniProt Q03431 (AlphaFold model), which also has an AlphaFold model), best resolution first:

5EMB 0.85 Å, Crystal structure of the SNX27 PDZ domain bound to the C-terminal phosphorylated PTHR…
4Z8J 0.95 Å, Crystal structure of the SNX27 PDZ domain bound to the C-terminal PTHR PDZ binding motif
7UZO 1.3 Å, Parathyroid hormone 1 receptor extracellular domain complexed with a peptide ligand…
3H3G 1.94 Å, Crystal structure of the extracellular domain of the human parathyroid hormone receptor…
3C4M 1.95 Å, Structure of human parathyroid hormone in complex with the extracellular domain of its…
8D51 2.0 Å, Parathyroid hormone 1 receptor extracellular domain complexed with a peptide ligand…
7UZP 2.29 Å, parathyroid hormone 1 receptor extracellular domain complexed with a peptide ligand…
8BIA 2.4 Å, Crystal structure of Scribble PDZ1 with PTHR
6FJ3 2.5 Å, High resolution crystal structure of parathyroid hormone 1 receptor in complex with a…
8FLQ 2.55 Å, Human PTH1R in complex with PTH(1-34) and Gs
8JR9 2.57 Å, Small molecule agonist (PCO371) bound to human parathyroid hormone receptor type 1 (PTH1R)
8YG4 2.59 Å, A cryo-EM structure of LA-PTH-R1-PTH1R-Gs complex structure

Browse structure collections

About this viewer

MolViewer shows 8D52 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.