3GGF: Human Serine/threonine-protein kinase MST4

Crystal structure of human Serine/threonine-protein kinase MST4 in complex with an quinazolin. Determined by X-ray diffraction at 2.35 Å resolution. Released 24 Mar 2009.

Method: X-ray diffraction
Resolution: 2.35 Å
Organism: Homo sapiens
Chains: 2
Atoms: 4,506
Mol. weight: 69.27 kDa
Ligands: CD, GVD
Released: 24 Mar 2009

Explore 3GGF in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

3GGF contains 36 α-helices and 22 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 18 helices, 11 β-strands

Element	Residues	Length	Sheet
α-helix	20-23	4
β-strand	24-32	9	1
β-strand	36-43	8	1
β-strand	49-56	8	1
α-helix	61-74	14
β-strand	82	1	2
α-helix	83-84	2
β-strand	85-91	7	1
β-strand	94-100	7	1
β-strand	105-106	2	2
α-helix	107-111	5
α-helix	115-117	3
α-helix	118-132	15
β-strand	141-142	2	3
α-helix	147-149	3
β-strand	150-152	3	2
β-strand	158-160	3	2
β-strand	164-165	2	3
α-helix	188-191	4
α-helix	199-214	16
α-helix	224-233	10
α-helix	235-237	3
α-helix	245-254	10
α-helix	259-261	3
α-helix	263-264	2
α-helix	265-269	5
α-helix	272-277	6
α-helix	281-284	4
α-helix	285-296	12

Chain B: 18 helices, 11 β-strands

Element	Residues	Length	Sheet
α-helix	20-23	4
β-strand	24-32	9	4
β-strand	36-43	8	4
β-strand	49-56	8	4
α-helix	61-74	14
β-strand	82	1	5
α-helix	83-84	2
β-strand	85-91	7	4
β-strand	94-99	6	4
β-strand	105-106	2	5
α-helix	107-111	5
α-helix	115-117	3
α-helix	118-132	15
β-strand	141-142	2	6
α-helix	147-149	3
β-strand	150-152	3	5
β-strand	158-160	3	5
β-strand	164-165	2	6
α-helix	188-191	4
α-helix	199-214	16
α-helix	224-230	7
α-helix	235-237	3
α-helix	245-254	10
α-helix	259-261	3
α-helix	263-264	2
α-helix	265-268	4
α-helix	272-277	6
α-helix	281-284	4
α-helix	285-296	12

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Serine/threonine-protein kinase MST4	A, B	protein	301	Homo sapiens	Q9P289 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>3GGF_1 Serine/threonine-protein kinase MST4 (chains A, B)
SMAHSPVAVQVPGMQNNIADPEELFTKLERIGKGSFGEVFKGIDNRTQQVVAIKIIDLEE
AEDEIEDIQQEITVLSQCDSSYVTKYYGSYLKGSKLWIIMEYLGGGSALDLLRAGPFDEF
QIATMLKEILKGLDYLHSEKKIHRDIKAANVLLSEQGDVKLADFGVAGQLTDTQIKRNTF
VGTPFWMAPEVIQQSAYDSKADIWSLGITAIELAKGEPPNSDMHPMRVLFLIPKNNPPTL
VGDFTKSFKEFIDACLNKDPSFRPTAKELLKHKFIVKNSKKTSYLTELIDRFKRWKAEGH
S

Ligands and cofactors

ID	Name	Formula	Copies
CD	Cadmium ion	Cd	7
GVD	[4-({4-[(5-cyclopropyl-1H-pyrazol-3-yl)amino]quinazolin-2-yl}imino)cyclohexa-2,…	C22 H19 N7	2

Primary citation

Structural comparison of human mammalian ste20-like kinases. Record, C.J., Chaikuad, A., Rellos, P. et al. PLoS One (2010) 5:e11905-e11905. DOI 10.1371/journal.pone.0011905 · PubMed

Other PDB entries of the same protein (UniProt Q9P289 (AlphaFold model), which also has an AlphaFold model), best resolution first:

5YF4 1.9 Å, A kinase complex MST4-MOB4
4GEH 1.95 Å, Crystal structure of MST4 dimerization domain complex with PDCD10
7B36 2.11 Å, MST4 in complex with compound G-5555
5XY9 2.3 Å, Structure of the MST4 and 14-3-3 complex
3W8I 2.4 Å, Crystal structure of CCM3 in complex with the C-terminal regulatory domain of MST4
4FZA 3.15 Å, Crystal structure of MST4-MO25 complex
4FZD 3.25 Å, Crystal structure of MST4-MO25 complex with WSF motif
4FZF 3.64 Å, Crystal structure of MST4-MO25 complex with DKI

Browse structure collections

About this viewer

MolViewer shows 3GGF directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.