Crystal structure of MST4-MO25 complex with DKI. Determined by X-ray diffraction at 3.64 Å resolution. Released 6 Mar 2013.
Explore 4FZF in 3D Show helices and sheets RCSB PDB PDBe
4FZF contains 43 α-helices and 15 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 12-14 | 3 | |
| α-helix | 16 | 1 | |
| α-helix | 17-23 | 7 | |
| α-helix | 24-26 | 3 | |
| α-helix | 38-54 | 17 | |
| β-strand | 56 | 1 | 1 |
| β-strand | 62 | 1 | 1 |
| α-helix | 65-68 | 4 | |
| α-helix | 71-73 | 3 | |
| α-helix | 81-84 | 4 | |
| α-helix | 92-105 | 14 | |
| β-strand | 110 | 1 | 2 |
| β-strand | 113 | 1 | 2 |
| α-helix | 115-118 | 4 | |
| α-helix | 125-132 | 8 | |
| α-helix | 133-135 | 3 | |
| α-helix | 140-150 | 11 | |
| α-helix | 154-161 | 8 | |
| α-helix | 165-168 | 4 | |
| α-helix | 169-172 | 4 | |
| α-helix | 178-192 | 15 | |
| α-helix | 196-205 | 10 | |
| α-helix | 207-217 | 11 | |
| α-helix | 223-237 | 15 | |
| α-helix | 243-249 | 7 | |
| α-helix | 253-262 | 10 | |
| α-helix | 268-281 | 14 | |
| α-helix | 289-306 | 18 | |
| α-helix | 317-332 | 16 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 20-23 | 4 | |
| β-strand | 24-26 | 3 | 3 |
| β-strand | 38-43 | 6 | 3 |
| β-strand | 49-55 | 7 | 3 |
| α-helix | 65-76 | 12 | |
| β-strand | 82 | 1 | 4 |
| α-helix | 83-84 | 2 | |
| β-strand | 85-91 | 7 | 3 |
| β-strand | 94-100 | 7 | 3 |
| β-strand | 105-106 | 2 | 4 |
| α-helix | 107-110 | 4 | |
| α-helix | 111-113 | 3 | |
| α-helix | 118-137 | 20 | |
| β-strand | 140-141 | 2 | 5 |
| α-helix | 147-149 | 3 | |
| β-strand | 150-152 | 3 | 4 |
| β-strand | 158-160 | 3 | 4 |
| α-helix | 162-164 | 3 | |
| β-strand | 166-167 | 2 | 5 |
| α-helix | 188-191 | 4 | |
| α-helix | 199-214 | 16 | |
| α-helix | 224-233 | 10 | |
| α-helix | 235-237 | 3 | |
| α-helix | 245-254 | 10 | |
| α-helix | 259-261 | 3 | |
| α-helix | 265-268 | 4 | |
| α-helix | 272-277 | 6 | |
| α-helix | 281-284 | 4 | |
| α-helix | 285-294 | 10 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Calcium-binding protein 39 | A | protein | 328 | Homo sapiens | Q9Y376 (AlphaFold model) |
| Serine/threonine-protein kinase MST4 | B | protein | 283 | Homo sapiens | Q9P289 (AlphaFold model) |
>4FZF_1 Calcium-binding protein 39 (chains A) GAMASPADIVKNLKESMAVLEKQDISDKKAEKATEEVSKNLVAMKEILYGTNEKEPQTEA VAQLAQELYNSGLLSTLVADLQLIDFEGKKDVAQIFNNILRRQIGTRTPTVEYICTQQNI LFMLLKGYESPEIALNCGIMLRECIRHEPLAKIILWSEQFYDFFRYVEMSTFDIASDAFA TFKDLLTRHKLLSAEFLEQHYDRFFSEYEKLLHSENYVTKRQSLKLLGELLLDRHNFTIM TKYISKPENLKLMMNLLRDKSRNIQFEAFHVFKVFVANPNKTQPILDILLKNQAKLIEFL SKFQNDRTEDEQFNDEKTYLVKQIRDLK
>4FZF_2 Serine/threonine-protein kinase MST4 (chains B) GAMADPEELFTKLERIGKGSFGEVFKGIDNRTQQVVAIKIIDLEEAEDEIEDIQQEITVL SQCDSSYVTKYYGSYLKGSKLWIIMEYLGGGSALDLLRAGPFDEFQIATMLKEILKGLDY LHSEKKIHRDIKAANVLLSEQGDVKLAAFGVAGQLTDTQIKRNTFVGTPFWMAPEVIQQS AYDSKADIWSLGITAIELAKGEPPNSDMHPMRVLFLIPKNNPPTLVGDFTKSFKEFIDAC LNKDPSFRPTAKELLKHKFIVKNSKKTSYLTELIDRFKRWKAE
| ID | Name | Formula | Copies |
|---|---|---|---|
| DKI | 5-amino-3-{[4-(aminosulfonyl)phenyl]amino}-N-(2,6-difluorophenyl)-1H-1,2,4-tria… | C15 H13 F2 N7 O2 S2 | 1 |
Structure of the MST4 in Complex with MO25 Provides Insights into Its Activation Mechanism. Shi, Z., Jiao, S., Zhang, Z. et al. Structure (2013) 21:449-461. DOI 10.1016/j.str.2013.01.007 · PubMed
Other PDB entries of the same protein (UniProt Q9Y376 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 4FZF directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.