4FZA: MST4-MO25 complex

Crystal structure of MST4-MO25 complex. Determined by X-ray diffraction at 3.15 Å resolution. Released 6 Mar 2013.

Method: X-ray diffraction
Resolution: 3.15 Å
Organism: Homo sapiens
Chains: 2
Atoms: 4,900
Mol. weight: 70.52 kDa
Released: 6 Mar 2013

Explore 4FZA in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

4FZA contains 40 α-helices and 13 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 24 helices, 2 β-strands

Element	Residues	Length	Sheet
α-helix	16-25	10
α-helix	33-36	4
α-helix	38-54	17
α-helix	64-71	8
α-helix	79-85	7
α-helix	86-88	3
α-helix	92-105	14
β-strand	110	1	1
β-strand	113	1	1
α-helix	115-118	4
α-helix	125-132	8
α-helix	133-135	3
α-helix	140-150	11
α-helix	154-161	8
α-helix	165-168	4
α-helix	169-172	4
α-helix	178-193	16
α-helix	196-205	10
α-helix	207-219	13
α-helix	223-237	15
α-helix	243-249	7
α-helix	253-262	10
α-helix	268-283	16
α-helix	289-297	9
α-helix	299-308	10
α-helix	317-331	15

Chain B: 16 helices, 11 β-strands

Element	Residues	Length	Sheet
α-helix	20-23	4
β-strand	24-29	6	2
β-strand	38-43	6	2
β-strand	49-55	7	2
α-helix	64-74	11
β-strand	82	1	3
β-strand	85-91	7	2
β-strand	94-100	7	2
β-strand	105-106	2	3
α-helix	107-111	5
α-helix	118-137	20
β-strand	140-141	2	4
α-helix	147-149	3
β-strand	150-152	3	3
β-strand	158-160	3	3
β-strand	166-167	2	4
α-helix	188-191	4
α-helix	199-214	16
α-helix	224-233	10
α-helix	235-237	3
α-helix	245-254	10
α-helix	259-261	3
α-helix	263-264	2
α-helix	265-268	4
α-helix	272-277	6
α-helix	281-284	4
α-helix	285-294	10

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Calcium-binding protein 39	A	protein	328	Homo sapiens	Q9Y376 (AlphaFold model)
Serine/threonine-protein kinase MST4	B	protein	283	Homo sapiens	Q9P289 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>4FZA_1 Calcium-binding protein 39 (chains A)
GAMASPADIVKNLKESMAVLEKQDISDKKAEKATEEVSKNLVAMKEILYGTNEKEPQTEA
VAQLAQELYNSGLLSTLVADLQLIDFEGKKDVAQIFNNILRRQIGTRTPTVEYICTQQNI
LFMLLKGYESPEIALNCGIMLRECIRHEPLAKIILWSEQFYDFFRYVEMSTFDIASDAFA
TFKDLLTRHKLLSAEFLEQHYDRFFSEYEKLLHSENYVTKRQSLKLLGELLLDRHNFTIM
TKYISKPENLKLMMNLLRDKSRNIQFEAFHVFKVFVANPNKTQPILDILLKNQAKLIEFL
SKFQNDRTEDEQFNDEKTYLVKQIRDLK

Sequence of entity 2 (B), FASTA

>4FZA_2 Serine/threonine-protein kinase MST4 (chains B)
GAMADPEELFTKLERIGKGSFGEVFKGIDNRTQQVVAIKIIDLEEAEDEIEDIQQEITVL
SQCDSSYVTKYYGSYLKGSKLWIIMEYLGGGSALDLLRAGPFDEFQIATMLKEILKGLDY
LHSEKKIHRDIKAANVLLSEQGDVKLAAFGVAGQLTDTQIKRNTFVGTPFWMAPEVIQQS
AYDSKADIWSLGITAIELAKGEPPNSDMHPMRVLFLIPKNNPPTLVGDFTKSFKEFIDAC
LNKDPSFRPTAKELLKHKFIVKNSKKTSYLTELIDRFKRWKAE

Primary citation

Structure of the MST4 in Complex with MO25 Provides Insights into Its Activation Mechanism. Shi, Z., Jiao, S., Zhang, Z. et al. Structure (2013) 21:449-461. DOI 10.1016/j.str.2013.01.007 · PubMed

Other PDB entries of the same protein (UniProt Q9Y376 (AlphaFold model), which also has an AlphaFold model), best resolution first:

1UPK 1.85 Å, Crystal structure of MO25 in complex with a C-terminal peptide of STRAD
3GNI 2.35 Å, Structure of STRAD and MO25
1UPL 2.6 Å, Crystal structure of MO25 alpha
2WTK 2.65 Å, Structure of the heterotrimeric LKB1-STRADalpha-MO25alpha complex
8VSU 2.86 Å, Cryo-EM structure of LKB1-STRADalpha-MO25alpha heterocomplex
4O27 3.19 Å, Crystal structure of MST3-MO25 complex with WIF motif
4FZD 3.25 Å, Crystal structure of MST4-MO25 complex with WSF motif
4NZW 3.58 Å, Crystal Structure of STK25-MO25 Complex
4FZF 3.64 Å, Crystal structure of MST4-MO25 complex with DKI

Browse structure collections

About this viewer

MolViewer shows 4FZA directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.