3GP7: Staphylococcal Enterotoxin B mutant N23YK97SK98S

Name: PDB 3GP7: Staphylococcal Enterotoxin B mutant N23YK97SK98S
Published: 2010-03-09
License: https://creativecommons.org/publicdomain/zero/1.0/
Keywords: toxin

Staphylococcal Enterotoxin B mutant N23YK97SK98S. Determined by X-ray diffraction at 1.9 Å resolution. Released 9 Mar 2010.

Method: X-ray diffraction
Resolution: 1.9 Å
Organism: Staphylococcus aureus
Chains: 2
Atoms: 4,182
Mol. weight: 56.75 kDa
Released: 9 Mar 2010

Explore 3GP7 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

3GP7 contains 20 α-helices and 34 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 10 helices, 17 β-strands

Element	Residues	Length	Sheet
α-helix	3-7	5
α-helix	12-13	2
α-helix	14-16	3
β-strand	17	1	1
α-helix	22-25	4
α-helix	26-28	3
β-strand	33-38	6	2
β-strand	42	1	3
β-strand	48-51	4	3
β-strand	63-67	5	3
α-helix	71-77	7
β-strand	82-86	5	2
β-strand	89	1	3
β-strand	111-115	5	3
β-strand	118-120	3	2
β-strand	125-138	14	4
β-strand	141-152	12	4
β-strand	154-156	3	5
α-helix	157-172	16
β-strand	182-191	10	4
β-strand	194-199	6	4
α-helix	202-203	2
β-strand	205	1	1
α-helix	210-214	5
α-helix	215-219	5
β-strand	222-224	3	5
β-strand	228-236	9	4

Chain B: 10 helices, 17 β-strands

Element	Residues	Length	Sheet
α-helix	3-6	4
α-helix	12-13	2
α-helix	14-16	3
β-strand	17	1	6
α-helix	22-25	4
α-helix	26-28	3
β-strand	33-39	7	7
β-strand	42	1	8
β-strand	48-51	4	8
β-strand	63-67	5	8
α-helix	71-77	7
β-strand	81-86	6	7
β-strand	89	1	8
β-strand	111-115	5	8
β-strand	118-120	3	7
β-strand	125-138	14	9
β-strand	141-152	12	9
β-strand	154-156	3	10
α-helix	157-172	16
β-strand	182-191	10	9
β-strand	194-199	6	9
α-helix	202-203	2
β-strand	205	1	6
α-helix	210-214	5
α-helix	215-219	5
β-strand	222-224	3	10
β-strand	228-236	9	9

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Enterotoxin type B	A, B	protein	239	Staphylococcus aureus	P01552 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>3GP7_1 Enterotoxin type B (chains A, B)
ESQPDPKPDELHKSSKFTGLMEYMKVLYDDNHVSAINVKSIDQFLYFDLIYSIKDTKLGN
YDNVRVEFKNKDLADKYKDKYVDVFGANYYYQCYFSSSTNDINSHQTDKRKTCMYGGVTE
HNGNQLDKYRSITVRVFEDGKNLLSFDVQTNKKKVTAQELDYLTRHYLVKNKKLYEFNNS
PYETGYIKFIENENSFWYDMMPAPGDKFDQSKYLMMYNDNKMVDSKDVKIEVYLTTKKK

Primary citation

Contribution of the flexible loop region to the function of staphylococcal enterotoxin B. Yanaka, S., Kudou, M., Tanaka, Y. et al. Protein Eng Des Sel (2010) 23:415-421. DOI 10.1093/protein/gzq006 · PubMed

Other PDB entries of the same protein (UniProt P01552 (AlphaFold model), which also has an AlphaFold model), best resolution first:

3SEB 1.48 Å, Staphylococcal enterotoxin B
8YBO 1.59 Å, Crystal structure of nanobody SEB-Nb11 bound to staphylococcal enterotoxin B (SEB)
4RGO 1.8 Å, Structure of Staphylococcal Enterotoxin B bound to the neutralizing antibody 14G8
1SE4 1.9 Å, Staphylococcal enterotoxin B complexed with lactose
1D5M 2.0 Å, X-ray crystal structure of HLA-DR4 complexed with peptide and seb
1D5Z 2.0 Å, X-ray crystal structure of HLA-DR4 complexed with peptidomimetic and seb
1GOZ 2.0 Å, Structural basis for the altered T-cell receptor binding specificty in a superantigenic…
8YBM 2.04 Å, Crystal structure of nanobody SEB-Nb6 bound to staphylococcal enterotoxin B (SEB)
8YKT 2.04 Å, Fab and SEB complex
8YBP 2.08 Å, Crystal structure of nanobody SEB-Nb20 bound to staphylococcal enterotoxin B (SEB)
8YBN 2.18 Å, Crystal structure of nanobody SEB-Nb8 bound to staphylococcal enterotoxin B (SEB)
1SE3 2.3 Å, Staphylococcal enterotoxin B complexed with GM3 trisaccharide

Browse structure collections

About this viewer

MolViewer shows 3GP7 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.