3GQQ: Protein unc-119 homolog A
Crystal structure of the human retinal protein 4 (unc-119 homolog A). Northeast Structural Genomics Consortium target HR3066a. Determined by X-ray diffraction at 1.95 Å resolution. Released 7 Apr 2009.
- Method
- X-ray diffraction
- Resolution
- 1.95 Å
- Organism
- Homo sapiens
- Chains
- 6
- Atoms
- 9,290
- Mol. weight
- 139.76 kDa
- Released
- 7 Apr 2009
Explore 3GQQ in 3D
Show helices and sheets
RCSB PDB
PDBe
Secondary structure: helices and β-sheets
3GQQ contains 33 α-helices and 60 β-strands across 6 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
Chain A: 6 helices, 11 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 62-64 | 3 | |
| α-helix | 79-81 | 3 | |
| β-strand | 87-95 | 9 | 1 |
| β-strand | 101-106 | 6 | 1 |
| β-strand | 128-132 | 5 | 2 |
| α-helix | 135-139 | 5 | |
| β-strand | 142-150 | 9 | 1 |
| β-strand | 156 | 1 | 3 |
| β-strand | 159-167 | 9 | 2 |
| β-strand | 170-178 | 9 | 2 |
| α-helix | 181 | 1 | |
| β-strand | 182 | 1 | 3 |
| α-helix | 183 | 1 | |
| β-strand | 187-195 | 9 | 1 |
| α-helix | 201-209 | 9 | |
| β-strand | 214-222 | 9 | 2 |
| β-strand | 225-235 | 11 | 2 |
Chain B: 5 helices, 9 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 62-65 | 4 | |
| α-helix | 79-81 | 3 | |
| β-strand | 87-95 | 9 | 4 |
| β-strand | 101-106 | 6 | 4 |
| β-strand | 128-132 | 5 | 5 |
| α-helix | 135-139 | 5 | |
| β-strand | 142-150 | 9 | 4 |
| β-strand | 160-167 | 8 | 5 |
| β-strand | 170-178 | 9 | 5 |
| β-strand | 187-195 | 9 | 4 |
| α-helix | 196-200 | 5 | |
| α-helix | 201-209 | 9 | |
| β-strand | 214-222 | 9 | 5 |
| β-strand | 225-235 | 11 | 5 |
Chain C: 6 helices, 9 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 58-60 | 3 | |
| α-helix | 62-65 | 4 | |
| α-helix | 79-81 | 3 | |
| β-strand | 87-95 | 9 | 6 |
| β-strand | 101-106 | 6 | 6 |
| β-strand | 128-132 | 5 | 7 |
| α-helix | 135-139 | 5 | |
| β-strand | 142-150 | 9 | 6 |
| β-strand | 160-167 | 8 | 7 |
| β-strand | 170-178 | 9 | 7 |
| β-strand | 187-195 | 9 | 6 |
| α-helix | 196-197 | 2 | |
| α-helix | 201-209 | 9 | |
| β-strand | 214-222 | 9 | 7 |
| β-strand | 225-235 | 11 | 7 |
Chain D: 5 helices, 11 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 62-64 | 3 | |
| α-helix | 79-81 | 3 | |
| β-strand | 87-95 | 9 | 8 |
| β-strand | 101-106 | 6 | 8 |
| β-strand | 128-132 | 5 | 9 |
| α-helix | 135-139 | 5 | |
| β-strand | 142-150 | 9 | 8 |
| β-strand | 156 | 1 | 10 |
| β-strand | 159-167 | 9 | 9 |
| β-strand | 170-178 | 9 | 9 |
| β-strand | 182 | 1 | 10 |
| β-strand | 187-195 | 9 | 8 |
| α-helix | 196-200 | 5 | |
| α-helix | 201-209 | 9 | |
| β-strand | 214-222 | 9 | 9 |
| β-strand | 225-235 | 11 | 9 |
Chain E: 7 helices, 11 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 62-64 | 3 | |
| α-helix | 79-81 | 3 | |
| β-strand | 87-95 | 9 | 11 |
| β-strand | 101-106 | 6 | 11 |
| β-strand | 128-132 | 5 | 12 |
| α-helix | 135-139 | 5 | |
| β-strand | 142-150 | 9 | 11 |
| β-strand | 156 | 1 | 13 |
| β-strand | 159-167 | 9 | 12 |
| β-strand | 170-178 | 9 | 12 |
| α-helix | 181 | 1 | |
| β-strand | 182 | 1 | 13 |
| α-helix | 183 | 1 | |
| β-strand | 187-195 | 9 | 11 |
| α-helix | 196-200 | 5 | |
| α-helix | 201-209 | 9 | |
| β-strand | 214-222 | 9 | 12 |
| β-strand | 225-235 | 11 | 12 |
Chain F: 4 helices, 9 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 62-64 | 3 | |
| α-helix | 79-81 | 3 | |
| β-strand | 87-95 | 9 | 14 |
| β-strand | 101-106 | 6 | 14 |
| β-strand | 128-132 | 5 | 15 |
| α-helix | 137-139 | 3 | |
| β-strand | 142-150 | 9 | 14 |
| β-strand | 159-167 | 9 | 15 |
| β-strand | 170-178 | 9 | 15 |
| β-strand | 187-195 | 9 | 14 |
| α-helix | 201-209 | 9 | |
| β-strand | 214-222 | 9 | 15 |
| β-strand | 225-235 | 11 | 15 |
Molecules and chains
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|
| Protein unc-119 homolog A | A, B, C, D, E, F | protein | 195 | Homo sapiens | Q13432 (AlphaFold model) |
Sequence of entity 1 (A, B, C, D, E, F), FASTA
>3GQQ_1 Protein unc-119 homolog A (chains A, B, C, D, E, F)
MGHHHHHHSHRKQPIGPEDVLGLQRITGDYLCSPEENIYKIDFVRFKIRDMDSGTVLFEI
KKPPVSERLPINRRDLDPNAGRFVRYQFTPAFLRLRQVGATVEFTVGDKPVNNFRMIERH
YFRNQLLKSFDFHFGFCIPSSKNTCEHIYDFPPLSEELISEMIRHPYETQSDSFYFVDDR
LVMHNKADYSYSGTP
Primary citation
Crystal structure of the human retinal protein 4 (unc-119 homolog A). Vorobiev, S.M., Chen, Y., Seetharaman, J. et al. To be published.
Other PDB entries of the same protein (UniProt Q13432 (AlphaFold model), which also has an AlphaFold model), best resolution first:
- 3RBQ 2.0 Å, Co-crystal structure of human UNC119 (retina gene 4) and an N-terminal Transducin-alpha…
- 6H6A 2.0 Å, Crystal structure of UNC119 in complex with LCK peptide
- 4GOJ 2.1 Å, The Crystal Structure of full length Arl3GppNHp in complex with UNC119a
- 5L7K 2.1 Å, The crystal structure of myristoylated NPHP3 peptide in complex with UNC119a
- 9GKG 2.21 Å, Crystal structure of UNC119 in complex with Squarunkin A
- 7UMO 2.3 Å, Structure of Unc119-inhibitor complex.
- 9NEM 2.49 Å, Structure of Unc119-Farnesylated peptide complex
- 4GOK 2.6 Å, The Crystal structure of Arl2GppNHp in complex with UNC119a
Browse structure collections
About this viewer
MolViewer shows 3GQQ directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.