3RBQ: Protein unc-119 homolog A

Co-crystal structure of human UNC119 (retina gene 4) and an N-terminal Transducin-alpha mimicking peptide. Determined by X-ray diffraction at 2.0 Å resolution. Released 8 Jun 2011.

Method: X-ray diffraction
Resolution: 2.0 Å
Organism: Homo sapiens
Chains: 12
Atoms: 9,360
Mol. weight: 145.2 kDa
Released: 8 Jun 2011

Explore 3RBQ in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

3RBQ contains 37 α-helices and 62 β-strands across 8 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 5 helices, 11 β-strands

Element	Residues	Length	Sheet
α-helix	62-64	3
α-helix	79-81	3
β-strand	87-95	9	1
β-strand	101-106	6	1
β-strand	128-132	5	2
α-helix	135-139	5
β-strand	142-150	9	1
β-strand	156	1	3
β-strand	159-167	9	2
β-strand	170-178	9	2
β-strand	182	1	3
β-strand	187-195	9	1
α-helix	196-200	5
α-helix	201-209	9
β-strand	214-222	9	2
β-strand	225-235	11	2

Chain B: 6 helices, 9 β-strands

Element	Residues	Length	Sheet
α-helix	62-65	4
α-helix	79-81	3
β-strand	87-95	9	4
β-strand	101-106	6	4
β-strand	128-132	5	5
α-helix	135-139	5
β-strand	142-150	9	4
β-strand	160-167	8	5
β-strand	170-178	9	5
α-helix	181-183	3
β-strand	187-195	9	4
α-helix	196-198	3
α-helix	201-209	9
β-strand	214-222	9	5
β-strand	225-235	11	5

Chain C: 5 helices, 9 β-strands

Element	Residues	Length	Sheet
α-helix	62-65	4
α-helix	79-81	3
β-strand	87-95	9	6
β-strand	101-106	6	6
β-strand	128-132	5	7
α-helix	135-139	5
β-strand	142-150	9	6
β-strand	159-167	9	7
β-strand	170-178	9	7
β-strand	187-195	9	6
α-helix	196-198	3
α-helix	201-209	9
β-strand	214-222	9	7
β-strand	225-235	11	7

Chain D: 5 helices, 11 β-strands

Element	Residues	Length	Sheet
α-helix	62-64	3
α-helix	79-81	3
β-strand	87-95	9	8
β-strand	101-106	6	8
β-strand	128-132	5	9
α-helix	135-139	5
β-strand	142-150	9	8
β-strand	156	1	10
β-strand	159-167	9	9
β-strand	170-178	9	9
β-strand	182	1	10
β-strand	187-195	9	8
α-helix	196-198	3
α-helix	201-209	9
β-strand	214-222	9	9
β-strand	225-235	11	9

Chain E: 7 helices, 11 β-strands

Element	Residues	Length	Sheet
α-helix	62-64	3
α-helix	79-81	3
β-strand	87-95	9	11
β-strand	101-106	6	11
β-strand	128-132	5	12
α-helix	135-139	5
β-strand	142-150	9	11
β-strand	156	1	13
β-strand	159-167	9	12
β-strand	170-178	9	12
α-helix	181	1
β-strand	182	1	13
α-helix	183	1
β-strand	187-195	9	11
α-helix	196-198	3
α-helix	201-209	9
β-strand	214-222	9	12
β-strand	225-235	11	12

Chain F: 7 helices, 11 β-strands

Element	Residues	Length	Sheet
α-helix	62-65	4
α-helix	79-81	3
β-strand	87-95	9	14
β-strand	101-106	6	14
β-strand	128-132	5	15
α-helix	137-139	3
β-strand	142-150	9	14
β-strand	156	1	16
β-strand	159-167	9	15
β-strand	170-178	9	15
α-helix	181	1
β-strand	182	1	16
α-helix	183	1
β-strand	187-195	9	14
α-helix	196-198	3
α-helix	201-209	9
β-strand	214-222	9	15
β-strand	225-235	11	15

Chain H: 1 helix, 0 β-strands

Element	Residues	Length	Sheet
α-helix	502-505	4

Chain L: 1 helix, 0 β-strands

Element	Residues	Length	Sheet
α-helix	502-506	5

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Protein unc-119 homolog A	A, B, C, D, E, F	protein	195	Homo sapiens	Q13432 (AlphaFold model)
Guanine nucleotide-binding protein G(t) subunit alpha-1	G, H, I, J, K, L	protein	11	Homo sapiens	P11488 (AlphaFold model)

Sequence of entity 1 (A, B, C, D, E, F), FASTA

>3RBQ_1 Protein unc-119 homolog A (chains A, B, C, D, E, F)
MGHHHHHHSHRKQPIGPEDVLGLQRITGDYLCSPEENIYKIDFVRFKIRDMDSGTVLFEI
KKPPVSERLPINRRDLDPNAGRFVRYQFTPAFLRLRQVGATVEFTVGDKPVNNFRMIERH
YFRNQLLKSFDFHFGFCIPSSKNTCEHIYDFPPLSEELISEMIRHPYETQSDSFYFVDDR
LVMHNKADYSYSGTP

Sequence of entity 2 (G, H, I, J, K, L), FASTA

>3RBQ_2 Guanine nucleotide-binding protein G(t) subunit alpha-1 (chains G, H, I, J, K, L)
XGAGASAEEKH

Primary citation

UNC119 is required for G protein trafficking in sensory neurons. Zhang, H., Constantine, R., Vorobiev, S. et al. Nat Neurosci (2011) 14:874-880. DOI 10.1038/nn.2835 · PubMed

Other PDB entries of the same protein (UniProt Q13432 (AlphaFold model), which also has an AlphaFold model), best resolution first:

3GQQ 1.95 Å, Crystal structure of the human retinal protein 4 (unc-119 homolog A). Northeast…
6H6A 2.0 Å, Crystal structure of UNC119 in complex with LCK peptide
4GOJ 2.1 Å, The Crystal Structure of full length Arl3GppNHp in complex with UNC119a
5L7K 2.1 Å, The crystal structure of myristoylated NPHP3 peptide in complex with UNC119a
9GKG 2.21 Å, Crystal structure of UNC119 in complex with Squarunkin A
7UMO 2.3 Å, Structure of Unc119-inhibitor complex.
9NEM 2.49 Å, Structure of Unc119-Farnesylated peptide complex
4GOK 2.6 Å, The Crystal structure of Arl2GppNHp in complex with UNC119a

Browse structure collections

About this viewer

MolViewer shows 3RBQ directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.