6H6A: UNC119

Crystal structure of UNC119 in complex with LCK peptide. Determined by X-ray diffraction at 2.0 Å resolution. Released 26 Sept 2018.

Method: X-ray diffraction
Resolution: 2.0 Å
Organism: Homo sapiens
Chains: 6
Atoms: 4,672
Mol. weight: 70.25 kDa
Ligands: 15P, MYR, PO4
Released: 26 Sept 2018

Explore 6H6A in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

6H6A contains 19 α-helices and 31 β-strands across 3 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain D: 7 helices, 11 β-strands

Element	Residues	Length	Sheet
α-helix	62-64	3
α-helix	79-81	3
β-strand	87-95	9	1
β-strand	101-106	6	1
β-strand	128-132	5	2
α-helix	135-139	5
β-strand	142-150	9	1
β-strand	156	1	3
β-strand	159-167	9	2
β-strand	170-178	9	2
α-helix	181	1
β-strand	182	1	3
α-helix	183	1
β-strand	187-195	9	1
α-helix	196-198	3
α-helix	201-209	9
β-strand	214-222	9	2
β-strand	225-235	11	2

Chain G: 5 helices, 9 β-strands

Element	Residues	Length	Sheet
α-helix	62-65	4
α-helix	79-81	3
β-strand	87-95	9	4
β-strand	101-106	6	4
β-strand	128-132	5	5
α-helix	135-139	5
β-strand	142-151	10	4
β-strand	156-167	12	5
β-strand	170-182	13	5
β-strand	186-195	10	4
α-helix	196-198	3
α-helix	201-209	9
β-strand	214-222	9	5
β-strand	225-235	11	5

Chain J: 7 helices, 11 β-strands

Element	Residues	Length	Sheet
α-helix	62-64	3
α-helix	79-81	3
β-strand	87-95	9	6
β-strand	101-106	6	6
β-strand	128-132	5	7
α-helix	135-139	5
β-strand	142-151	10	6
β-strand	156	1	8
β-strand	159-167	9	7
β-strand	170-178	9	7
α-helix	181	1
β-strand	182	1	8
α-helix	183	1
β-strand	186-195	10	6
α-helix	196-198	3
α-helix	201-209	9
β-strand	214-222	9	7
β-strand	225-235	11	7

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Protein unc-119 homolog A	D	protein	182	Homo sapiens	Q13432 (AlphaFold model)
Gly-cys-gly-cys-ser-ser	E, H, K	protein	10	Homo sapiens	P06239 (AlphaFold model)
Protein unc-119 homolog A	G, J	protein	182	Homo sapiens	Q13432 (AlphaFold model)

Sequence of entity 1 (D), FASTA

>6H6A_1 Protein unc-119 homolog A (chains D)
PIGPEDVLGLQRITGDYLCSPEENIYKIDFVRFKIRDMDSGTVLFEIKKPPVSERLPINR
RDKDPNAGRFVRYQFTPAFLRLRQVGATVEFTVGDKPVNNFRMIERHYFRNQLLKSFDFH
FGFCIPSSKNTCEHIYDFPPLSEELISEMIRHPYETQSDSFYFVDDRLVMHNKADYSYSG
TP

Sequence of entity 2 (E, H, K), FASTA

>6H6A_2 GLY-CYS-GLY-CYS-SER-SER (chains E, H, K)
GCGCSSHPED

Sequence of entity 3 (G, J), FASTA

>6H6A_3 Protein unc-119 homolog A (chains G, J)
PIGPEDVLGLQRITGDYLCSPEENIYKIDFVRFKIRDMDSGTVLFEIKKPPVSERLPINR
RDLDPNAGRFVRYQFTPAFLRLRQVGATVEFTVGDKPVNNFRMIERHYFRNQLLKSFDFH
FGFCIPSSKNTCEHIYDFPPLSEELISEMIRHPYETQSDSFYFVDDRLVMHNKADYSYSG
TP

Ligands and cofactors

ID	Name	Formula	Copies
15P	Polyethylene glycol (N=34)	C69 H140 O35	1
MYR	Myristic acid	C14 H28 O2	3
PO4	Phosphate ion	O4 P	2

Water and common crystallization additives (GOL) are not listed.

Primary citation

The Ciliary Machinery Is Repurposed for T Cell Immune Synapse Trafficking of LCK. Stephen, L.A., ElMaghloob, Y., McIlwraith, M.J. et al. Dev Cell (2018) 47:122-132.e4. DOI 10.1016/j.devcel.2018.08.012 · PubMed

Other PDB entries of the same protein (UniProt Q13432 (AlphaFold model), which also has an AlphaFold model), best resolution first:

3GQQ 1.95 Å, Crystal structure of the human retinal protein 4 (unc-119 homolog A). Northeast…
3RBQ 2.0 Å, Co-crystal structure of human UNC119 (retina gene 4) and an N-terminal Transducin-alpha…
4GOJ 2.1 Å, The Crystal Structure of full length Arl3GppNHp in complex with UNC119a
5L7K 2.1 Å, The crystal structure of myristoylated NPHP3 peptide in complex with UNC119a
9GKG 2.21 Å, Crystal structure of UNC119 in complex with Squarunkin A
7UMO 2.3 Å, Structure of Unc119-inhibitor complex.
9NEM 2.49 Å, Structure of Unc119-Farnesylated peptide complex
4GOK 2.6 Å, The Crystal structure of Arl2GppNHp in complex with UNC119a

Browse structure collections

About this viewer

MolViewer shows 6H6A directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.