3HM5: DNA methyltransferase 1-associated protein 1

SANT domain of human DNA methyltransferase 1 associated protein 1. Determined by X-ray diffraction at 1.8 Å resolution. Released 16 Jun 2009.

Method: X-ray diffraction
Resolution: 1.8 Å
Organism: Homo sapiens
Chains: 1
Atoms: 687
Mol. weight: 11.26 kDa
Ligands: CA
Released: 16 Jun 2009

Explore 3HM5 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

3HM5 contains 5 α-helices and 2 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 5 helices, 2 β-strands

Element	Residues	Length	Sheet
α-helix	140-142	3
α-helix	143-147	5
β-strand	149	1	1
β-strand	152	1	1
α-helix	154-166	13
α-helix	171-177	7
α-helix	188-205	18

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
DNA methyltransferase 1-associated protein 1	A	protein	93	Homo sapiens	Q9NPF5 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>3HM5_1 DNA methyltransferase 1-associated protein 1 (chains A)
GGKDYPFARFNKTVQVPVYSEQEYQLYLHDDAWTKAETDHLFDLSRRFDLRFVVIHDRYD
HQQFKKRSVEDLKERYYHICAKLANVRAVPGTD

Ligands and cofactors

ID	Name	Formula	Copies
CA	Calcium ion	Ca	1

Water and common crystallization additives (UNX) are not listed.

Primary citation

SANT domain of human DNA methyltransferase 1 associated protein 1. Dombrovski, L., Tempel, W., Amaya, M.F. et al. To be published.

Other PDB entries of the same protein (UniProt Q9NPF5 (AlphaFold model), which also has an AlphaFold model), best resolution first:

4IEJ 1.45 Å, Crystal structure of a DNA methyltransferase 1 associated protein 1 (DMAP1) from Homo…
8QR1 2.4 Å, Cryo-EM structure of the human Tip60 complex
9C57 2.75 Å, Reconstituted P400 Subcomplex of the human TIP60 complex
9CAE 3.07 Å, Cryo-EM structure of the reconstituted RuvBL lobe of the human TIP60 complex (composite…
8X15 3.2 Å, Structure of nucleosome-bound SRCAP-C in the apo state
8X19 3.2 Å, Structure of nucleosome-bound SRCAP-C in the ADP-BeFx-bound state
8X1C 3.2 Å, Structure of nucleosome-bound SRCAP-C in the ADP-bound state
8XVT 3.2 Å, The core subcomplex of human NuA4/TIP60 complex
9C6N 3.29 Å, ARP module of the human TIP60 complex
9CAC 3.43 Å, Cryo-EM structure of the RuvBL lobe of the native human TIP60 complex (composite…
9Y3G 4.1 Å, Extended cryo-EM structure of human SRCAP-CFDP1-nucleosome complex in the activated state
9Y3F 4.5 Å, Extended cryo-EM structure of human SRCAP-CFDP1-nucleosome complex in the poised state

Browse structure collections

About this viewer

MolViewer shows 3HM5 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.