4IEJ: DNA methyltransferase 1-associated protein 1

Crystal structure of a DNA methyltransferase 1 associated protein 1 (DMAP1) from Homo sapiens at 1.45 A resolution. Determined by X-ray diffraction at 1.45 Å resolution. Released 2 Jan 2013.

Method: X-ray diffraction
Resolution: 1.45 Å
Organism: Homo sapiens
Chains: 1
Atoms: 795
Mol. weight: 11.26 kDa
Ligands: CA
Released: 2 Jan 2013

Explore 4IEJ in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

4IEJ contains 6 α-helices and 2 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 6 helices, 2 β-strands

Element	Residues	Length	Sheet
α-helix	134-136	3
α-helix	140-142	3
α-helix	143-147	5
β-strand	149	1	1
β-strand	152	1	1
α-helix	154-166	13
α-helix	171-177	7
α-helix	188-205	18

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
DNA methyltransferase 1-associated protein 1	A	protein	93	Homo sapiens	Q9NPF5 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>4IEJ_1 DNA methyltransferase 1-associated protein 1 (chains A)
GGKDYPFARFNKTVQVPVYSEQEYQLYLHDDAWTKAETDHLFDLSRRFDLRFVVIHDRYD
HQQFKKRSVEDLKERYYHICAKLANVRAVPGTD

Ligands and cofactors

ID	Name	Formula	Copies
CA	Calcium ion	Ca	1

Primary citation

Crystal structure of a DNA methyltransferase 1 associated protein 1 (DMAP1) from Homo sapiens at 1.45 A resolution. Joint Center for Structural Genomics (JCSG), Partnership for T-Cell Biology. To be published.

Other PDB entries of the same protein (UniProt Q9NPF5 (AlphaFold model), which also has an AlphaFold model), best resolution first:

3HM5 1.8 Å, SANT domain of human DNA methyltransferase 1 associated protein 1
8QR1 2.4 Å, Cryo-EM structure of the human Tip60 complex
9C57 2.75 Å, Reconstituted P400 Subcomplex of the human TIP60 complex
9CAE 3.07 Å, Cryo-EM structure of the reconstituted RuvBL lobe of the human TIP60 complex (composite…
8X15 3.2 Å, Structure of nucleosome-bound SRCAP-C in the apo state
8X19 3.2 Å, Structure of nucleosome-bound SRCAP-C in the ADP-BeFx-bound state
8X1C 3.2 Å, Structure of nucleosome-bound SRCAP-C in the ADP-bound state
8XVT 3.2 Å, The core subcomplex of human NuA4/TIP60 complex
9C6N 3.29 Å, ARP module of the human TIP60 complex
9CAC 3.43 Å, Cryo-EM structure of the RuvBL lobe of the native human TIP60 complex (composite…
9Y3G 4.1 Å, Extended cryo-EM structure of human SRCAP-CFDP1-nucleosome complex in the activated state
9Y3F 4.5 Å, Extended cryo-EM structure of human SRCAP-CFDP1-nucleosome complex in the poised state

Browse structure collections

About this viewer

MolViewer shows 4IEJ directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.