3HNB: Coagulation factor VIII

Factor VIII Trp2313-His2315 segment is involved in membrane binding as shown by crystal structure of complex between factor VIII C2 domain and an inhibitor. Determined by X-ray diffraction at 1.15 Å resolution. Released 19 Jan 2010.

Method: X-ray diffraction
Resolution: 1.15 Å
Organism: Homo sapiens
Chains: 1
Atoms: 1,613
Mol. weight: 18.49 kDa
Ligands: 768
Released: 19 Jan 2010

Explore 3HNB in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

3HNB contains 3 α-helices and 17 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain M: 3 helices, 17 β-strands

Element	Residues	Length	Sheet
β-strand	2176-2177	2	1
α-helix	2187-2189	3
β-strand	2190-2192	3	1
β-strand	2197	1	2
β-strand	2202	1	2
α-helix	2205-2207	3
β-strand	2209	1	1
β-strand	2219	1	3
β-strand	2230-2246	17	1
β-strand	2248-2250	3	4
β-strand	2253-2255	3	4
β-strand	2256-2265	10	1
β-strand	2272-2273	2	1
α-helix	2274	1
β-strand	2275-2276	2	5
β-strand	2279-2280	2	5
β-strand	2283-2284	2	1
β-strand	2293-2314	22	1
β-strand	2319	1	3
β-strand	2320-2327	8	1

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Coagulation factor VIII	M	protein	159	Homo sapiens	P00451 (AlphaFold model)

Sequence of entity 1 (M), FASTA

>3HNB_1 Coagulation factor VIII (chains M)
DLNSCSMPLGMESKAISDAQITASSYFTNMFATWSPSKARLHLQGRSNAWRPQVNNPKEW
LQVDFQKTMKVTGVTTQGVKSLLTSMYVKEFLISSSQDGHQWTLFFQNGKVKVFQGNQDS
FTPVVNSLDPPLLTRYLRIHPQSWVHQIALRMEVLGCEA

Ligands and cofactors

ID	Name	Formula	Copies
768	(2R)-1-(2,4-dichlorophenoxy)-3-[(2E)-2-imino-3-(2-piperidin-1-ylethyl)-2,3-dihy…	C23 H28 Cl2 N4 O2	1

Primary citation

Trp2313-His2315 of factor VIII C2 domain is involved in membrane binding: structure of a complex between the C2 domain and an inhibitor of membrane binding. Liu, Z., Lin, L., Yuan, C. et al. J Biol Chem (2010) 285:8824-8829. DOI 10.1074/jbc.M109.080168 · PubMed

Other PDB entries of the same protein (UniProt P00451 (AlphaFold model), which also has an AlphaFold model), best resolution first:

3HNY 1.07 Å, Factor VIII Trp2313-His2315 segment is involved in membrane binding as shown by crystal…
1D7P 1.5 Å, Crystal structure of the c2 domain of human factor viii at 1.5 a resolution at 1.5 A
9D5D 1.83 Å, Crystal Structure of Blood Coagulation Factor VIII C2 Domain Mutant L2251A/L2252A
1IQD 2.0 Å, Human Factor VIII C2 Domain complexed to human monoclonal BO2C11 Fab.
3HOB 2.07 Å, Factor VIII Trp2313-His2315 segment is involved in membrane binding as shown by crystal…
4PT6 2.1 Å, The discobody: an engineered discoidin domain from factor VIII that binds v 3 integrin…
4KI5 2.47 Å, Cystal structure of human factor VIII C2 domain in a ternary complex with murine…
4XZU 2.61 Å, Crystal Structure of the Human Factor VIII C2 Domain in Complex with Murine 3E6…
7KWO 2.9 Å, Rfviiifc-vwf-xten (BIVV001)
36JL 3.15 Å, Coagulation factor VIII, full-length, membrane-bound, on Ptd-choline : Ptd-serine 75:25…
9JBV 3.17 Å, Structure of Engineered Coagulation Factor VIII with Enhanced Secretion and Coagulation…
6MF0 3.2 Å, Crystal Structure Determination of Human/Porcine Chimera Coagulation Factor VIII

Browse structure collections

About this viewer

MolViewer shows 3HNB directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.