Factor VIII Trp2313-His2315 segment is involved in membrane binding as shown by crystal structure of complex between factor VIII C2 domain and an inhibitor. Determined by X-ray diffraction at 1.07 Å resolution. Released 19 Jan 2010.
Explore 3HNY in 3D Show helices and sheets RCSB PDB PDBe
3HNY contains 3 α-helices and 17 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 2176-2177 | 2 | 1 |
| α-helix | 2187-2189 | 3 | |
| β-strand | 2190-2192 | 3 | 1 |
| β-strand | 2197 | 1 | 2 |
| β-strand | 2202 | 1 | 2 |
| α-helix | 2205-2207 | 3 | |
| β-strand | 2209 | 1 | 1 |
| β-strand | 2219 | 1 | 3 |
| β-strand | 2230-2246 | 17 | 1 |
| β-strand | 2248-2250 | 3 | 4 |
| β-strand | 2253-2255 | 3 | 4 |
| β-strand | 2256-2265 | 10 | 1 |
| β-strand | 2272-2273 | 2 | 1 |
| α-helix | 2274 | 1 | |
| β-strand | 2275-2276 | 2 | 5 |
| β-strand | 2279-2280 | 2 | 5 |
| β-strand | 2283-2284 | 2 | 1 |
| β-strand | 2293-2314 | 22 | 1 |
| β-strand | 2319 | 1 | 3 |
| β-strand | 2320-2327 | 8 | 1 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Coagulation factor VIII | M | protein | 159 | Homo sapiens | P00451 (AlphaFold model) |
>3HNY_1 Coagulation factor VIII (chains M) DLNSCSMPLGMESKAISDAQITASSYFTNMFATWSPSKARLHLQGRSNAWRPQVNNPKEW LQVDFQKTMKVTGVTTQGVKSLLTSMYVKEFLISSSQDGHQWTLFFQNGKVKVFQGNQDS FTPVVNSLDPPLLTRYLRIHPQSWVHQIALRMEVLGCEA
Trp2313-His2315 of factor VIII C2 domain is involved in membrane binding: structure of a complex between the C2 domain and an inhibitor of membrane binding. Liu, Z., Lin, L., Yuan, C. et al. J Biol Chem (2010) 285:8824-8829. DOI 10.1074/jbc.M109.080168 · PubMed
Other PDB entries of the same protein (UniProt P00451 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 3HNY directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.