3IMY: TR-beta

Structure of TR-beta bound to selective thyromimetic GC-1. Determined by X-ray diffraction at 2.55 Å resolution. Released 8 Sept 2009.

Method: X-ray diffraction
Resolution: 2.55 Å
Organism: Homo sapiens
Chains: 1
Atoms: 2,088
Mol. weight: 30.18 kDa
Ligands: B72
Released: 8 Sept 2009

Explore 3IMY in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

3IMY contains 15 α-helices and 4 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 15 helices, 4 β-strands

Element	Residues	Length	Sheet
α-helix	202-208	7
α-helix	212-214	3
α-helix	216-231	16
β-strand	244-245	2	1
α-helix	266-288	23
α-helix	291-294	4
α-helix	298-318	21
β-strand	321-322	2	1
β-strand	327-330	4	1
β-strand	334-336	3	1
α-helix	338-341	4
α-helix	342-346	5
α-helix	348-360	13
α-helix	361-363	3
α-helix	367-378	12
α-helix	389-410	22
α-helix	417-445	29
α-helix	448-450	3
α-helix	453-459	7

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Thyroid hormone receptor beta	A	protein	261	Homo sapiens	P10828 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>3IMY_1 Thyroid hormone receptor beta (chains A)
MEELQKSIGHKPEPTDEEWELIKTVTEAHVATNAQGSHWKQKRKFLPEDIGQAPIVNAPE
GGKVDLEAFSHFTKIITPAITRVVDFAKKLPMFCELPCEDQIILLKGCCMEIMSLRAAVR
YDPESETLTLNGEMAVTRGQLKNGGLGVVSDAIFDLGMSLSSFNLDDTEVALLQAVLLMS
SDRPGLACVERIEKYQDSFLLAFEHYINYRKHHVTHFWPKLLMKVTDLRMIGACHASRFL
HMKVECPTELFPPLFLEVFED

Ligands and cofactors

ID	Name	Formula	Copies
B72	{4-[4-hydroxy-3-(1-methylethyl)benzyl]-3,5-dimethylphenoxy}acetic acid	C20 H24 O4	1

Primary citation

Structural basis of GC-1 selectivity for thyroid hormone receptor isoforms. Bleicher, L., Aparicio, R., Nunes, F.M. et al. BMC Struct Biol (2008) 8:1-13. DOI 10.1186/1472-6807-8-8 · PubMed

Other PDB entries of the same protein (UniProt P10828 (AlphaFold model), which also has an AlphaFold model), best resolution first:

6KKB 1.7 Å, A novel agonist of THRb
2NLL 1.9 Å, Retinoid X receptor-thyroid hormone receptor DNA-binding domain heterodimer bound to…
7WMH 1.97 Å, A novel chemical derivative(56) of THRB agonist
1N46 2.2 Å, Crystal structure of human tr beta ligand-binding domain complexed with a potent…
2J4A 2.2 Å, Human Thyroid hormone receptor beta ligand binding domain in complex with KB131084
3D57 2.2 Å, TR Variant D355R
3GWS 2.2 Å, Crystal Structure of T3-Bound Thyroid Hormone Receptor
2PIN 2.3 Å, Thyroid receptor beta in complex with inhibitor
7WLX 2.39 Å, A novel chemical derivative(53) of THRB agonist
1NQ0 2.4 Å, TR Receptor Mutations Conferring Hormone Resistance and Reduced Corepressor Release…
1NQ2 2.4 Å, Two RTH Mutants with Impaired Hormone Binding
1XZX 2.5 Å, Thyroxine-Thyroid Hormone Receptor Interactions

Browse structure collections

About this viewer

MolViewer shows 3IMY directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.