3JAE: Glycine receptor subunit alphaZ1

Structure of alpha-1 glycine receptor by single particle electron cryo-microscopy, glycine-bound state. Determined by electron microscopy at 3.9 Å resolution. Released 9 Sept 2015.

Method: Electron microscopy
Resolution: 3.9 Å
Organism: Danio rerio
Chains: 5
Atoms: 12,825
Mol. weight: 198.24 kDa
Released: 9 Sept 2015

Explore 3JAE in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

3JAE contains 65 α-helices and 70 β-strands across 5 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chains A, B, C, D and E: 13 helices, 14 β-strands

Element	Residues	Length	Sheet
α-helix	26-33	8
α-helix	37-39	3
α-helix	45	1
α-helix	52	1
β-strand	53-65	13	1
β-strand	73-85	13	1
β-strand	98-100	3	1
α-helix	105-107	3
β-strand	115-116	2	2
β-strand	122-124	3	1
β-strand	132-137	6	1
β-strand	141-153	13	1
β-strand	165-173	9	2
β-strand	182-185	4	1
β-strand	192-194	3	1
β-strand	200	1	2
β-strand	203-205	3	2
β-strand	211-217	7	2
β-strand	222-234	13	2
α-helix	236-239	4
α-helix	240-244	5
α-helix	245-259	15
α-helix	265-287	23
α-helix	291-292	2
α-helix	296-297	2
α-helix	298-324	27
α-helix	330-362	33

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Glycine receptor subunit alphaZ1	A, B, C, D, E	protein	342	Danio rerio	O93430 (AlphaFold model)

Sequence of entity 1 (A, B, C, D, E), FASTA

>3JAE_1 Glycine receptor subunit alphaZ1 (chains A, B, C, D, E)
APSEFLDKLMGKVSGYDARIRPNFKGPPVNVTCNIFINSFGSIAETTMDYRVNIFLRQQW
NDPRLAYSEYPDDSLDLDPSMLDSIWKPDLFFANEKGANFHEVTTDNKLLRISKNGNVLY
SIRITLVLACPMDLKNFPMDVQTCIMQLESFGYTMNDLIFEWDEKGAVQVADGLTLPQFI
LKEEKDLRYCTKHYNTGKFTCIEARFHLERQMGYYLIQMYIPSLLIVILSWVSFWINMDA
APARVGLGITTVLTMTTQSSGSRASLPKVSYVKAIDIWMAVCLLFVFSALLEYAAVNFIA
RAGTKLFISRAKRIDTVSRVAFPLVFLIFNIFYWITYKLVPR

Primary citation

Glycine receptor mechanism elucidated by electron cryo-microscopy. Du, J., Lu, W., Wu, S. et al. Nature (2015) 526:224-229. DOI 10.1038/nature14853 · PubMed

Other PDB entries of the same protein (UniProt O93430 (AlphaFold model), which also has an AlphaFold model), best resolution first:

7M6N 2.61 Å, Full length alpha1 Glycine receptor in presence of 0.1mM Glycine
7U2N 2.8 Å, A novel compound mimics the structural and functional effects of the full agonist…
7M6O 2.84 Å, Full length alpha1 Glycine receptor in presence of 0.1mM Glycine and 32uM…
6PLX 2.9 Å, CryoEM structure of zebra fish alpha-1 glycine receptor bound with GABA in SMA,…
6PLY 2.9 Å, CryoEM structure of zebra fish alpha-1 glycine receptor bound with GABA in SMA, open state
6PM6 2.9 Å, CryoEM structure of zebra fish alpha-1 glycine receptor bound with Glycine in SMA, open…
6PXD 2.9 Å, CryoEM structure of zebra fish alpha-1 glycine receptor, Apo state
7U2M 2.9 Å, A novel compound mimics the structural and functional effects of the full agonist…
7M6Q 2.91 Å, Full length alpha1 Glycine receptor in presence of 1mM Glycine and 32uM…
6PLS 3.0 Å, CryoEM structure of zebra fish alpha-1 glycine receptor bound with taurine in nanodisc,…
6PLW 3.0 Å, CryoEM structure of zebra fish alpha-1 glycine receptor bound with GABA in SMA,…
6PLZ 3.0 Å, CryoEM structure of zebra fish alpha-1 glycine receptor bound with GABA in SMA, closed…

Browse more

3JAE is part of these collections:

Neurotransmission and the synapse

About this viewer

MolViewer shows 3JAE directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.