Crystal structure of the E95K mutant of the Indian Hedgehog N-terminal signalling domain. Determined by X-ray diffraction at 1.5 Å resolution. Released 26 Jan 2011.
Explore 3K7H in 3D Show helices and sheets RCSB PDB PDBe
3K7H contains 7 α-helices and 8 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 43-48 | 6 | |
| β-strand | 52-53 | 2 | 1 |
| α-helix | 76-80 | 5 | |
| β-strand | 82-83 | 2 | 2 |
| β-strand | 89-91 | 3 | 1 |
| α-helix | 99-101 | 3 | |
| β-strand | 102-103 | 2 | 2 |
| α-helix | 105-121 | 17 | |
| β-strand | 127-131 | 5 | 1 |
| α-helix | 144-147 | 4 | |
| β-strand | 150-155 | 6 | 1 |
| α-helix | 160-162 | 3 | |
| α-helix | 163-172 | 10 | |
| β-strand | 177-182 | 6 | 1 |
| β-strand | 185-189 | 5 | 1 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Indian hedgehog protein | B | protein | 187 | Homo sapiens | Q14623 (AlphaFold model) |
>3K7H_1 Indian hedgehog protein (chains B) MRGSHHHHHHGSCGPGRVVGSRRRPPRKLVPLAYKQFSPNVPEKTLGASGRYEGKIARSS ERFKELTPNYNPDIIFKDEKNTGADRLMTQRCKDRLNSLAISVMNQWPGVKLRVTEGWDE DGHHSEESLHYEGRAVDITTSDRDRNKYGLLARLAVEAGFDWVYYESKAHVHCSVKSEHS AAAKTGG
| ID | Name | Formula | Copies |
|---|---|---|---|
| ZN | Zinc ion | Zn | 1 |
Water and common crystallization additives (SO4) are not listed.
Crystal structure of the E95K mutant of the Indian Hedgehog N-terminal signalling domain. He, Y.-X., Kang, Y., Zhang, W.J. et al. To be published.
Other PDB entries of the same protein (UniProt Q14623 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 3K7H directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.