3N1F: IhhN

Crystal Structure of IhhN bound to CDOFn3. Determined by X-ray diffraction at 1.6 Å resolution. Released 2 Jun 2010.

Method: X-ray diffraction
Resolution: 1.6 Å
Organism: Homo sapiens
Chains: 4
Atoms: 4,799
Mol. weight: 61.94 kDa
Ligands: CA, ZN
Released: 2 Jun 2010

Explore 3N1F in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

3N1F contains 22 α-helices and 32 β-strands across 4 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 7 helices, 8 β-strands

Element	Residues	Length	Sheet
α-helix	46-48	3
β-strand	52-53	2	1
α-helix	76-80	5
β-strand	82-83	2	2
β-strand	89-91	3	1
α-helix	99-101	3
β-strand	102-103	2	2
α-helix	105-121	17
β-strand	127-131	5	1
α-helix	144-147	4
β-strand	150-155	6	1
α-helix	160-162	3
α-helix	163-172	10
β-strand	177-182	6	1
β-strand	185-189	5	1

Chain B: 7 helices, 8 β-strands

Element	Residues	Length	Sheet
α-helix	46-48	3
β-strand	52-53	2	3
α-helix	77-80	4
β-strand	82-83	2	4
β-strand	89-91	3	3
α-helix	99-101	3
β-strand	102-103	2	4
α-helix	105-121	17
β-strand	127-131	5	3
α-helix	144-147	4
β-strand	150-155	6	3
α-helix	160-162	3
α-helix	163-172	10
β-strand	177-182	6	3
β-strand	185-189	5	3

Chain C: 4 helices, 8 β-strands

Element	Residues	Length	Sheet
α-helix	829-830	2
β-strand	831-837	7	5
β-strand	843-848	6	5
β-strand	861-868	8	6
α-helix	874-876	3
β-strand	878-883	6	6
β-strand	888-891	4	5
α-helix	894-895	2
β-strand	899-908	10	6
β-strand	911-912	2	6
α-helix	913-915	3
β-strand	919-922	4	6

Chain D: 4 helices, 8 β-strands

Element	Residues	Length	Sheet
β-strand	831-837	7	7
β-strand	843-848	6	7
α-helix	851-854	4
β-strand	861-868	8	8
α-helix	874-876	3
β-strand	878-883	6	8
β-strand	888-891	4	7
α-helix	894-895	2
β-strand	899-908	10	8
β-strand	911-912	2	8
α-helix	913-915	3
β-strand	919-922	4	8

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Indian hedgehog protein	A, B	protein	169	Homo sapiens	Q14623 (AlphaFold model)
Cell adhesion molecule-related/down-regulated by oncogenes	C, D	protein	102	Homo sapiens	Q4KMG0 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>3N1F_1 Indian hedgehog protein (chains A, B)
GSGPGPGRVVGSRRRPPRKLVPLAYKQFSPNVPEKTLGASGRYEGKIARSSERFKELTPN
YNPDIIFKDEENTGADRLMTQRCKDRLNSLAISVMNQWPGVKLRVTEGWDEDGHHSEESL
HYEGRAVDITTSDRDRNKYGLLARLAVEAGFDWVYYESKAHVHCSVKSE

Sequence of entity 2 (C, D), FASTA

>3N1F_2 Cell adhesion molecule-related/down-regulated by oncogenes (chains C, D)
GSTPITGPHIAYTEAVSDTQIMLKWTYIPSSNNNTPIQGFYIYYRPTDSDNDSDYKRDVV
EGSKQWHMIGHLQPETSYDIKMQCFNEGGESEFSNVMICETK

Ligands and cofactors

ID	Name	Formula	Copies
CA	Calcium ion	Ca	6
ZN	Zinc ion	Zn	2

Primary citation

All mammalian Hedgehog proteins interact with cell adhesion molecule, down-regulated by oncogenes (CDO) and brother of CDO (BOC) in a conserved manner. Kavran, J.M., Ward, M.D., Oladosu, O.O. et al. J Biol Chem (2010) 285:24584-24590. DOI 10.1074/jbc.M110.131680 · PubMed

Other PDB entries of the same protein (UniProt Q14623 (AlphaFold model), which also has an AlphaFold model), best resolution first:

3K7I 1.44 Å, Crystal structure of the E131K mutant of the Indian Hedgehog N-terminal signalling domain
3K7G 1.5 Å, Crystal structure of the Indian Hedgehog N-terminal signalling domain
3K7H 1.5 Å, Crystal structure of the E95K mutant of the Indian Hedgehog N-terminal signalling domain
3N1M 1.69 Å, Crystal Structure of IhhN bound to BOCFn3
3K7J 1.9 Å, Crystal structure of the D100E mutant of the Indian Hedgehog N-terminal signalling domain
3N1O 2.55 Å, Crystal structure of IhhN
3N1P 2.7 Å, Crystal Structure of IhhN bound to BOCFn3

Browse structure collections

About this viewer

MolViewer shows 3N1F directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.