3N1P: IhhN

Crystal Structure of IhhN bound to BOCFn3. Determined by X-ray diffraction at 2.7 Å resolution. Released 2 Jun 2010.

Method: X-ray diffraction
Resolution: 2.7 Å
Organism: Homo sapiens
Chains: 2
Atoms: 2,048
Mol. weight: 32 kDa
Ligands: ZN, CA
Released: 2 Jun 2010

Explore 3N1P in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

3N1P contains 5 α-helices and 19 β-strands across 2 chains. Residue ranges use sequence positions (label_seq_id) from RCSB, which can differ from the residue numbers in the file. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain B: 5 helices, 8 β-strands

Element	Residues	Length	Sheet
β-strand	28-29	2	A
α-helix	51-57	7
β-strand	58-59	2	B
β-strand	65-67	3	A
α-helix	74-76	3
β-strand	78-79	2	B
α-helix	80-98	19
β-strand	103-107	5	A
β-strand	126-131	6	A
α-helix	135-137	3
α-helix	138-149	12
β-strand	153-155	3	A
β-strand	162-165	4	A

Chain C: 0 helices, 11 β-strands

Element	Residues	Length	Sheet
β-strand	11-17	7	C
β-strand	23-28	6	C
β-strand	42-48	7	D
β-strand	42-48	7	E
β-strand	58-62	5	D
β-strand	58-62	5	E
β-strand	68-71	4	C
β-strand	79-88	10	D
β-strand	79-88	10	E
β-strand	91-92	2	D
β-strand	99-102	4	E

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Indian hedgehog protein	B	protein	169	Homo sapiens	Q14623 (AlphaFold model)
Brother of CDO	C	protein	111	Homo sapiens	Q9BWV1 (AlphaFold model)

Sequence of entity 1 (B), FASTA

>3N1P_1 Indian hedgehog protein (chains B)
GSGPGPGRVVGSRRRPPRKLVPLAYKQFSPNVPEKTLGASGRYEGKIARSSERFKELTPN
YNPDIIFKDEENTGADRLMTQRCKDRLNSLAISVMNQWPGVKLRVTEGWDEDGHHSEESL
HYEGRAVDITTSDRDRNKYGLLARLAVEAGFDWVYYESKAHVHCSVKSE

Sequence of entity 2 (C), FASTA

>3N1P_2 Brother of CDO (chains C)
GSTERPVAGPYITFTDAVNETTIMLKWMYIPASNNNTPIHGFYIYYRPTDSDNDSDYKKD
MVEGDKYWHSISHLQPETSYDIKMQCFNEGGESEFSNVMICETKARKSSGQ

Ligands and cofactors

ID	Name	Formula	Copies
ZN	Zinc ion	Zn	1
CA	Calcium ion	Ca	2

Primary citation

All mammalian Hedgehog proteins interact with cell adhesion molecule, down-regulated by oncogenes (CDO) and brother of CDO (BOC) in a conserved manner. Kavran, J.M., Ward, M.D., Oladosu, O.O. et al. J Biol Chem (2010) 285:24584-24590. DOI 10.1074/jbc.M110.131680 · PubMed

Other PDB entries of the same protein (UniProt Q14623 (AlphaFold model), which also has an AlphaFold model), best resolution first:

3K7I 1.44 Å, Crystal structure of the E131K mutant of the Indian Hedgehog N-terminal signalling domain
3K7G 1.5 Å, Crystal structure of the Indian Hedgehog N-terminal signalling domain
3K7H 1.5 Å, Crystal structure of the E95K mutant of the Indian Hedgehog N-terminal signalling domain
3N1F 1.6 Å, Crystal Structure of IhhN bound to CDOFn3
3N1M 1.69 Å, Crystal Structure of IhhN bound to BOCFn3
3K7J 1.9 Å, Crystal structure of the D100E mutant of the Indian Hedgehog N-terminal signalling domain
3N1O 2.55 Å, Crystal structure of IhhN

Browse structure collections

About this viewer

MolViewer shows 3N1P directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.