3K7I: Indian hedgehog protein

Crystal structure of the E131K mutant of the Indian Hedgehog N-terminal signalling domain. Determined by X-ray diffraction at 1.44 Å resolution. Released 26 Jan 2011.

Method: X-ray diffraction
Resolution: 1.44 Å
Organism: Homo sapiens
Chains: 1
Atoms: 1,622
Mol. weight: 21.47 kDa
Ligands: ZN
Released: 26 Jan 2011

Explore 3K7I in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

3K7I contains 7 α-helices and 8 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain B: 7 helices, 8 β-strands

Element	Residues	Length	Sheet
α-helix	45-48	4
β-strand	52-53	2	1
α-helix	76-80	5
β-strand	82-83	2	2
β-strand	89-91	3	1
α-helix	99-101	3
β-strand	102-103	2	2
α-helix	105-121	17
β-strand	127-131	5	1
α-helix	144-147	4
β-strand	150-155	6	1
α-helix	160-162	3
α-helix	163-172	10
β-strand	177-182	6	1
β-strand	185-189	5	1

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Indian hedgehog protein	B	protein	187	Homo sapiens	Q14623 (AlphaFold model)

Sequence of entity 1 (B), FASTA

>3K7I_1 Indian hedgehog protein (chains B)
MRGSHHHHHHGSCGPGRVVGSRRRPPRKLVPLAYKQFSPNVPEKTLGASGRYEGKIARSS
ERFKELTPNYNPDIIFKDEENTGADRLMTQRCKDRLNSLAISVMNQWPGVKLRVTKGWDE
DGHHSEESLHYEGRAVDITTSDRDRNKYGLLARLAVEAGFDWVYYESKAHVHCSVKSEHS
AAAKTGG

Ligands and cofactors

ID	Name	Formula	Copies
ZN	Zinc ion	Zn	1

Water and common crystallization additives (SO4) are not listed.

Primary citation

Crystal structure of the E131K mutant of the Indian Hedgehog N-terminal signalling domain. He, Y.-X., Kang, Y., Zhang, W.J. et al. To be published.

Other PDB entries of the same protein (UniProt Q14623 (AlphaFold model), which also has an AlphaFold model), best resolution first:

3K7G 1.5 Å, Crystal structure of the Indian Hedgehog N-terminal signalling domain
3K7H 1.5 Å, Crystal structure of the E95K mutant of the Indian Hedgehog N-terminal signalling domain
3N1F 1.6 Å, Crystal Structure of IhhN bound to CDOFn3
3N1M 1.69 Å, Crystal Structure of IhhN bound to BOCFn3
3K7J 1.9 Å, Crystal structure of the D100E mutant of the Indian Hedgehog N-terminal signalling domain
3N1O 2.55 Å, Crystal structure of IhhN
3N1P 2.7 Å, Crystal Structure of IhhN bound to BOCFn3

Browse structure collections

About this viewer

MolViewer shows 3K7I directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.