3KS9: Metabotropic glutamate receptor mGluR1

Metabotropic glutamate receptor mGluR1 complexed with LY341495 antagonist. Determined by X-ray diffraction at 1.9 Å resolution. Released 8 Dec 2009.

Method: X-ray diffraction
Resolution: 1.9 Å
Organism: Homo sapiens
Chains: 2
Atoms: 7,727
Mol. weight: 112.58 kDa
Ligands: NAG, MG, Z99
Released: 8 Dec 2009

Explore 3KS9 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

3KS9 contains 44 α-helices and 40 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 21 helices, 20 β-strands

Element	Residues	Length	Sheet
β-strand	39-41	3	1
β-strand	45-51	7	1
β-strand	54	1	2
α-helix	55-58	4
α-helix	59-61	3
β-strand	70	1	2
α-helix	72-76	5
α-helix	77-90	14
β-strand	101-107	7	1
α-helix	112-123	12
β-strand	156-160	5	1
α-helix	165-175	11
α-helix	176-178	3
β-strand	182-184	3	1
α-helix	190-193	4
β-strand	201-203	3	1
α-helix	209-221	13
β-strand	226-232	7	3
α-helix	235-250	16
β-strand	254-261	8	3
α-helix	267-278	12
β-strand	286-290	5	3
α-helix	293-306	14
β-strand	313-316	4	3
α-helix	324-327	4
α-helix	331-334	4
β-strand	338-342	5	3
α-helix	348-354	7
α-helix	368-375	8
β-strand	379	1	4
β-strand	393	1	4
α-helix	394	1
α-helix	410-431	22
α-helix	440-442	3
α-helix	447-455	9
β-strand	458-460	3	5
β-strand	466-468	3	5
α-helix	474-476	3
β-strand	478-486	9	3
β-strand	492-501	10	3
β-strand	504-507	4	3

Chain B: 23 helices, 20 β-strands

Element	Residues	Length	Sheet
β-strand	39-41	3	6
β-strand	45-51	7	6
β-strand	54	1	7
α-helix	55-58	4
α-helix	59-64	6
β-strand	70	1	7
α-helix	72-76	5
α-helix	77-91	15
β-strand	101-107	7	6
α-helix	112-124	13
β-strand	156-160	5	6
α-helix	165-175	11
α-helix	176-178	3
β-strand	182-184	3	6
α-helix	190-193	4
β-strand	201-203	3	6
α-helix	209-221	13
β-strand	226-232	7	8
α-helix	235-248	14
α-helix	253	1
β-strand	254-261	8	8
α-helix	267-279	13
β-strand	286-290	5	8
α-helix	293-306	14
β-strand	313-316	4	8
α-helix	324-327	4
α-helix	331-334	4
β-strand	338-342	5	8
α-helix	348-354	7
α-helix	368-375	8
β-strand	379	1	9
β-strand	393	1	9
α-helix	394	1
α-helix	410-431	22
α-helix	440-442	3
α-helix	447-455	9
β-strand	458-460	3	10
α-helix	465	1
β-strand	466-468	3	10
α-helix	474-476	3
β-strand	478-486	9	8
β-strand	492-501	10	8
β-strand	504-507	4	8

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Metabotropic glutamate receptor 1	A, B	protein	496	Homo sapiens	Q13255 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>3KS9_1 Metabotropic glutamate receptor 1 (chains A, B)
LLAGASSQRSVARMDGDVIIGALFSVHHQPPAEKVPERKCGEIREQYGIQRVEAMFHTLD
KINADPVLLPNITLGSEIRDSCWHSSVALEQSIEFIRDSLISIRDEKDGINRCLPDGQSL
PPGRTKKPIAGVIGPGSSSVAIQVQNLLQLFDIPQIAYSATSIDLSDKTLYKYFLRVVPS
DTLQARAMLDIVKRYNWTYVSAVHTEGNYGESGMDAFKELAAQEGLSIAHSDKIYSNAGE
KSFDRLLRKLRERLPKARVVVCFCEGMTVRGLLSAMRRLGVVGEFSLIGSDGWADRDEVI
EGYEVEANGGITIKLQSPEVRSFDDYFLKLRLDTNTRNPWFPEFWQHRFQCRLPGHLLEN
PNFKRICTGNESLEENYVQDSKMGFVINAIYAMAHGLQNMHHALCPGHVGLCDAMKPIDG
SKLLDFLIKSSFIGVSGEEVWFDEKGDAPGRYDIMNLQYTEANRYDYVHVGTWHEGVLNI
DDYKIQMNKSGLVPRG

Ligands and cofactors

ID	Name	Formula	Copies
NAG	2-acetamido-2-deoxy-beta-D-glucopyranose	C8 H15 N O6	2
MG	Magnesium ion	Mg	2
Z99	2-[(1S,2S)-2-carboxycyclopropyl]-3-(9H-xanthen-9-yl)-D-alanine	C20 H19 N O5	2

Primary citation

Metabotropic glutamate receptor mglur1 complexed with LY341495 antagonist. Dobrovetsky, E., Khutoreskaya, G., Seitova, A. et al. To be published.

Other PDB entries of the same protein (UniProt Q13255 (AlphaFold model), which also has an AlphaFold model), best resolution first:

4OR2 2.8 Å, Human class C G protein-coupled metabotropic glutamate receptor 1 in complex with a…
9WQO 2.9 Å, GRM1-Acc State Conformation 1
27TM 3.2 Å, GRM1-Acc State Conformation 2
9WQM 3.3 Å, GRM1-Gi Complex Structure
7DGE 3.65 Å, intermediate state of class C GPCR
9WQN 3.7 Å, GRM1-Gq Complex Structure
7DGD 3.96 Å, apo state of class C GPCR

Browse structure collections

About this viewer

MolViewer shows 3KS9 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.