7DGD: Apo state of class C GPCR

apo state of class C GPCR. Determined by electron microscopy at 3.96 Å resolution. Released 22 Sept 2021.

Method: Electron microscopy
Resolution: 3.96 Å
Organism: Homo sapiens
Chains: 2
Atoms: 12,381
Mol. weight: 186.6 kDa
Released: 22 Sept 2021

Explore 7DGD in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

7DGD contains 70 α-helices and 65 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 35 helices, 28 β-strands

Element	Residues	Length	Sheet
β-strand	39-41	3	1
β-strand	45-49	5	1
β-strand	54	1	2
α-helix	56-58	3
β-strand	70	1	2
α-helix	76-79	4
α-helix	81-91	11
β-strand	101-105	5	1
α-helix	112-131	20
β-strand	156-159	4	1
α-helix	168-175	8
β-strand	182-184	3	1
α-helix	190-193	4
β-strand	201-203	3	1
α-helix	208-220	13
β-strand	228	1	3
β-strand	229-231	3	4
β-strand	232	1	5
α-helix	235-248	14
β-strand	257	1	3
β-strand	261	1	5
α-helix	267-277	11
β-strand	288-290	3	4
α-helix	293-305	13
β-strand	315	1	4
α-helix	318-320	3
β-strand	337-342	6	6
α-helix	348-354	7
α-helix	359-361	3
α-helix	368-376	9
α-helix	408-410	3
α-helix	411-421	11
α-helix	423-430	8
α-helix	448-455	8
β-strand	458	1	7
α-helix	466-467	2
β-strand	468	1	7
α-helix	474-476	3
β-strand	479-486	8	6
β-strand	492-499	8	6
β-strand	533-535	3	8
β-strand	547-549	3	8
α-helix	550-551	2
β-strand	554-555	2	9
β-strand	563-564	2	9
α-helix	565-566	2
β-strand	569-571	3	10
α-helix	573-575	3
β-strand	578-580	3	10
α-helix	594-614	21
α-helix	621-625	5
α-helix	628-648	21
α-helix	654-662	9
α-helix	663-667	5
α-helix	668-688	21
α-helix	703-712	10
α-helix	714-727	14
β-strand	732	1	11
β-strand	746	1	11
α-helix	750-769	20
α-helix	773-775	3
α-helix	783-807	25
α-helix	811-836	26

Chain B: 35 helices, 37 β-strands

Element	Residues	Length	Sheet
β-strand	39-41	3	12
β-strand	45-49	5	12
β-strand	54	1	13
β-strand	70	1	13
α-helix	76-86	11
α-helix	99-100	2
β-strand	101-105	5	12
α-helix	115-118	4
α-helix	119-121	3
α-helix	126-131	6
β-strand	156-160	5	12
α-helix	167-170	4
β-strand	182-184	3	12
β-strand	201-203	3	12
α-helix	208-219	12
β-strand	226-231	6	14
β-strand	232	1	15
α-helix	235-251	17
β-strand	254-258	5	14
β-strand	261	1	15
α-helix	267-277	11
β-strand	287-290	4	14
α-helix	293-306	14
β-strand	314-316	3	14
α-helix	331-333	3
β-strand	338	1	16
β-strand	341-342	2	17
α-helix	345-347	3
α-helix	348-355	8
α-helix	372-376	5
α-helix	410-430	21
α-helix	450-454	5
β-strand	458-460	3	18
α-helix	465	1
β-strand	466-468	3	18
β-strand	474	1	12
α-helix	475-476	2
β-strand	478-480	3	17
β-strand	483	1	16
β-strand	484-486	3	19
β-strand	492-494	3	19
β-strand	498-501	4	17
β-strand	504-507	4	17
α-helix	509-511	3
β-strand	533-535	3	20
α-helix	545-546	2
β-strand	547-549	3	20
α-helix	550-551	2
β-strand	554-558	5	21
β-strand	561-564	4	21
α-helix	565-566	2
β-strand	570	1	22
α-helix	573-575	3
β-strand	579	1	22
α-helix	591-612	22
β-strand	623	1	23
β-strand	626	1	23
α-helix	628-648	21
α-helix	656-662	7
α-helix	663-667	5
α-helix	668-688	21
α-helix	703-725	23
β-strand	732-733	2	24
β-strand	738	1	25
β-strand	741	1	25
β-strand	745-746	2	24
α-helix	750-754	5
α-helix	757-769	13
α-helix	783-799	17
α-helix	801-807	7
α-helix	811-828	18
α-helix	831-838	8

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Metabotropic glutamate receptor 1	A, B	protein	833	Homo sapiens	Q13255 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>7DGD_1 Metabotropic glutamate receptor 1 (chains A, B)
GASSQRSVARMDGDVIIGALFSVHHQPPAEKVPERKCGEIREQYGIQRVEAMFHTLDKIN
ADPVLLPNITLGSEIRDSCWHSSVALEQSIEFIRDSLISIRDEKDGINRCLPDGQSLPPG
RTKKPIAGVIGPGSSSVAIQVQNLLQLFDIPQIAYSATSIDLSDKTLYKYFLRVVPSDTL
QARAMLDIVKRYNWTYVSAVHTEGNYGESGMDAFKELAAQEGLCIAHSDKIYSNAGEKSF
DRLLRKLRERLPKARVVVCFCEGMTVRGLLSAMRRLGVVGEFSLIGSDGWADRDEVIEGY
EVEANGGITIKLQSPEVRSFDDYFLKLRLDTNTRNPWFPEFWQHRFQCRLPGHLLENPNF
KRICTGNESLEENYVQDSKMGFVINAIYAMAHGLQNMHHALCPGHVGLCDAMKPIDGSKL
LDFLIKSSFIGVSGEEVWFDEKGDAPGRYDIMNLQYTEANRYDYVHVGTWHEGVLNIDDY
KIQMNKSGVVRSVCSEPCLKGQIKVIRKGEVSCCWICTACKENEYVQDEFTCKACDLGWW
PNADLTGCEPIPVRYLEWSNIESIIAIAFSCLGILVTLFVTLIFVLYRDTPVVKSSSREL
CYIILAGIFLGYVCPFTLIAKPTTTSCYLQRLLVGLSSAMCYSALVTKTNRIARILAGSK
KKICTRKPRFMSAWAQVIIASILISVQLTLVVTLIIMEPPMPILSYPSIKEVYLICNTSN
LGVVAPLGYNGLLIMSCTYYAFKTRNVPANFNEAKYIAFTMYTTCIIWLAFVPIYFGSNY
KIITTCFAVSLSVTVALGCMFTPKMYIIIAKPERNVRSAFTTSDVVRMHVGDG

Primary citation

Structural insights into the activation initiation of full-length mGlu1. Zhang, J., Qu, L., Wu, L. et al. Protein Cell (2021) 12:662-667. DOI 10.1007/s13238-020-00808-5 · PubMed

Other PDB entries of the same protein (UniProt Q13255 (AlphaFold model), which also has an AlphaFold model), best resolution first:

3KS9 1.9 Å, Metabotropic glutamate receptor mGluR1 complexed with LY341495 antagonist
4OR2 2.8 Å, Human class C G protein-coupled metabotropic glutamate receptor 1 in complex with a…
9WQO 2.9 Å, GRM1-Acc State Conformation 1
27TM 3.2 Å, GRM1-Acc State Conformation 2
9WQM 3.3 Å, GRM1-Gi Complex Structure
7DGE 3.65 Å, intermediate state of class C GPCR
9WQN 3.7 Å, GRM1-Gq Complex Structure

Browse structure collections

About this viewer

MolViewer shows 7DGD directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.