4OR2: PDB entry 4OR2

Human class C G protein-coupled metabotropic glutamate receptor 1 in complex with a negative allosteric modulator. Determined by X-ray diffraction at 2.8 Å resolution. Released 19 Mar 2014.

Method: X-ray diffraction
Resolution: 2.8 Å
Organisms: Escherichia coli, Homo sapiens
Chains: 2
Atoms: 5,906
Mol. weight: 91.11 kDa
Ligands: FM9, CLR, OLA, OLC
Released: 19 Mar 2014

Explore 4OR2 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

4OR2 contains 37 α-helices and 6 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 18 helices, 3 β-strands

Element	Residues	Length	Sheet
α-helix	1003-1018	16
α-helix	1024-1041	18
α-helix	1046-1048	3
α-helix	1056-1081	26
α-helix	1084-1097	14
α-helix	1098-1102	5
α-helix	1103-1105	3
β-strand	583-584	2	1
α-helix	591-616	26
α-helix	621-624	4
α-helix	628-649	22
α-helix	654-685	32
α-helix	697-698	2
α-helix	703-727	25
β-strand	732-735	4	1
β-strand	742-746	5	1
α-helix	750-773	24
α-helix	779-807	29
α-helix	811-825	15
α-helix	826-831	6
α-helix	832-839	8

Chain B: 19 helices, 3 β-strands

Element	Residues	Length	Sheet
α-helix	1003-1018	16
α-helix	1024-1041	18
α-helix	1046-1048	3
α-helix	1056-1081	26
α-helix	1084-1097	14
α-helix	1098-1102	5
α-helix	1103-1105	3
β-strand	584	1	2
α-helix	591-616	26
α-helix	621-624	4
α-helix	628-649	22
α-helix	654-685	32
α-helix	697-698	2
α-helix	703-727	25
β-strand	732-735	4	2
β-strand	743-746	4	2
α-helix	751-773	23
α-helix	779-807	29
α-helix	811-826	16
α-helix	827-831	5
α-helix	832-839	8
α-helix	842-845	4

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Soluble cytochrome b562, Metabotropic glutamate receptor 1	A, B	protein	389	Escherichia coli, Homo sapiens	P0ABE7 (AlphaFold model), Q13255 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>4OR2_1 Soluble cytochrome b562, Metabotropic glutamate receptor 1 (chains A, B)
GGTADLEDNWETLNDNLKVIEKADNAAQVKDALTKMRAAALDAQKATPPKLEDKSPDSPE
MKDFRHGFDILVGQIDDALKLANEGKVKEAQAAAEQLKTTRNAYIQKYLIPVRYLEWSNI
ESIIAIAFSCLGILVTLFVTLIFVLYRDTPVVKSSSRELCYIILAGIFLGYVCPFTLIAK
PTTTSCYLQRLLVGLSSAMCYSALVTKTNRIARILAGSKKKICTRKPRFMSAWAQVIIAS
ILISVQLTLVVTLIIMEPPMPILSYPSIKEVYLICNTSNLGVVAPLGYNGLLIMSCTYYA
FKTRNVPANFNEAKYIAFTMYTTCIIWLAFVPIYFGSNYKIITTCFAVSLSVTVALGCMF
TPKMYIIIAKPERNVRSAFTTSDVVRMHV

Ligands and cofactors

ID	Name	Formula	Copies
FM9	4-fluoro-N-methyl-N-{4-[6-(propan-2-ylamino)pyrimidin-4-yl]-1,3-thiazol-2-yl}be…	C18 H18 F N5 O S	2
CLR	Cholesterol	C27 H46 O	6
OLA	Oleic acid	C18 H34 O2	1
OLC	(2R)-2,3-dihydroxypropyl (9Z)-octadec-9-enoate	C21 H40 O4	3
PO4	Phosphate ion	O4 P	2

Primary citation

Structure of a class C GPCR metabotropic glutamate receptor 1 bound to an allosteric modulator. Wu, H., Wang, C., Gregory, K.J. et al. Science (2014) 344:58-64. DOI 10.1126/science.1249489 · PubMed

Other PDB entries of the same protein (UniProt P0ABE7 (AlphaFold model), which also has an AlphaFold model), best resolution first:

6DYF 1.1 Å, Cu(II)-bound structure of the engineered cyt cb562 variant, CH3Y
5YO6 1.2 Å, Crystal Structure of B562RIL with engineered disulfide bond T9C-A36C
4JEA 1.22 Å, Crystal structure of an engineered Zn-RIDC1 construct with four interfacial disulfide…
7LSJ 1.26 Å, Cu-bound crystal structure of the engineered cyt cb562 variant, DiCyt2 - H63A,…
7MK4 1.27 Å, Co-bound crystal structure of the engineered cyt cb562 variant, DiCyt2
6DYC 1.33 Å, Co(II)-bound structure of the engineered cyt cb562 variant, CH3
5YO4 1.37 Å, Crystal Structure of B562RIL with engineered disulfide bond K27C-A79C
256B 1.4 Å, Improvement of the 2.5 Å resolution model of cytochrome B562 by redetermining the…
6OT4 1.4 Å, Bimetallic dodecameric cage design 2 (BMC2) from cytochrome cb562
7LRV 1.4 Å, Ni-bound crystal structure of the engineered cyt cb562 variant, DiCyt2, crystallized in…
9PQ4 1.48 Å, Bi-bound structure of the H77C variant of TriCyt2
6DYG 1.49 Å, Fe(II)-bound structure of the engineered cyt cb562 variant, CH3Y

Browse more

4OR2 is part of these collections:

GPCRs and cell signaling

About this viewer

MolViewer shows 4OR2 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.