3KZE: T-cell Lymphoma Invasion and Metastasis-1 PDZ

Crystal Structure of T-cell Lymphoma Invasion and Metastasis-1 PDZ in Complex With SSRKEYYA Peptide. Determined by X-ray diffraction at 1.8 Å resolution. Released 21 Apr 2010.

Method: X-ray diffraction
Resolution: 1.8 Å
Organism: Homo sapiens
Chains: 5
Atoms: 2,304
Mol. weight: 32.47 kDa
Released: 21 Apr 2010

Explore 3KZE in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

3KZE contains 11 α-helices and 20 β-strands across 5 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 3 helices, 6 β-strands

Element	Residues	Length	Sheet
β-strand	842-849	8	1
β-strand	860-867	8	1
β-strand	870-878	9	1
α-helix	883-886	4
β-strand	894-898	5	1
β-strand	901-902	2	1
α-helix	903-905	3
α-helix	908-914	7
β-strand	919-926	8	1

Chain B: 5 helices, 6 β-strands

Element	Residues	Length	Sheet
β-strand	842-849	8	2
α-helix	850-852	3
β-strand	860-867	8	2
β-strand	870-878	9	2
α-helix	883-886	4
β-strand	894-898	5	2
β-strand	901-902	2	2
α-helix	903-905	3
α-helix	908-916	9
β-strand	919-926	8	2
α-helix	927-929	3

Chain C: 3 helices, 6 β-strands

Element	Residues	Length	Sheet
β-strand	842-849	8	3
β-strand	860-865	6	3
β-strand	872-878	7	3
α-helix	883-887	5
β-strand	894-898	5	3
β-strand	901-902	2	3
α-helix	903-905	3
α-helix	908-916	9
β-strand	919-926	8	3

Chain D: 0 helices, 1 β-strand

Element	Residues	Length	Sheet
β-strand	3-7	5	2

Chain E: 0 helices, 1 β-strand

Element	Residues	Length	Sheet
β-strand	6-7	2	3

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
T-lymphoma invasion and metastasis-inducing protein 1	A, B, C	protein	94	Homo sapiens	Q13009 (AlphaFold model)
Synthetic Peptide	D, E	protein	8

Sequence of entity 1 (A, B, C), FASTA

>3KZE_1 T-lymphoma invasion and metastasis-inducing protein 1 (chains A, B, C)
GAMGKVTHSIHIEKSDTAADTYGFSLSSVEEDGIRRLYVNSVKETGLASKKGLKAGDEIL
EINNRAADALNSSMLKDFLSQPSLGLLVRTYPEL

Sequence of entity 2 (D, E), FASTA

>3KZE_2 Synthetic Peptide (chains D, E)
SSRKEYYA

Primary citation

The Tiam1 PDZ domain couples to Syndecan1 and promotes cell-matrix adhesion. Shepherd, T.R., Klaus, S.M., Liu, X. et al. J Mol Biol (2010) 398:730-746. DOI 10.1016/j.jmb.2010.03.047 · PubMed

Other PDB entries of the same protein (UniProt Q13009 (AlphaFold model), which also has an AlphaFold model), best resolution first:

3KZD 1.3 Å, Crystal Structure of Free T-cell Lymphoma Invasion and Metastasis-1 PDZ Domain
4GVC 1.54 Å, Crystal Structure of T-cell Lymphoma Invasion and Metastasis-1 PDZ in complex with…
4GVD 1.85 Å, Crystal Structure of T-cell Lymphoma Invasion and Metastasis-1 PDZ in complex with…
4NXR 1.9 Å, Crystal Structure of T-cell Lymphoma Invasion and Metastasis-1 PDZ Domain Quadruple…
4K2P 1.98 Å, The Structure of a Quintuple Mutant of the Tiam1 PH-CC-Ex Domain
4NXQ 2.1 Å, Crystal Structure of T-cell Lymphoma Invasion and Metastasis-1 PDZ Domain Quadruple…
4K2O 2.15 Å, The Structure of a Triple Mutant of the Tiam1 PH-CC-Ex Domain
4NXP 2.3 Å, Crystal Structure of Free T-cell Lymphoma Invasion and Metastasis-1 PDZ Domain Quadruple…
2D8I Solution structure of the PDZ domain of T-cell lymphoma invasion and metastasis 1 varian

Browse structure collections

About this viewer

MolViewer shows 3KZE directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.