3L0M: DrrA

Crystal structure of Rab1-activation domain and P4M domain of SidM/DrrA from legionella. Determined by X-ray diffraction at 3.45 Å resolution. Released 22 Dec 2009.

Method: X-ray diffraction
Resolution: 3.45 Å
Organism: Legionella pneumophila
Chains: 2
Atoms: 5,119
Mol. weight: 76.86 kDa
Released: 22 Dec 2009

Explore 3L0M in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

3L0M contains 31 α-helices and 4 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 16 helices, 2 β-strands

Element	Residues	Length	Sheet
α-helix	319-361	43
α-helix	365-381	17
α-helix	386-389	4
α-helix	391-393	3
α-helix	400-420	21
α-helix	428-445	18
α-helix	464-478	15
β-strand	484-485	2	1
β-strand	488-489	2	1
α-helix	490-506	17
α-helix	512-520	9
α-helix	526-529	4
α-helix	565-578	14
α-helix	579-581	3
α-helix	585-596	12
α-helix	600-605	6
α-helix	610-613	4
α-helix	620-634	15

Chain B: 15 helices, 2 β-strands

Element	Residues	Length	Sheet
α-helix	319-361	43
α-helix	365-381	17
α-helix	386-389	4
α-helix	391-393	3
α-helix	402-420	19
α-helix	429-445	17
α-helix	464-478	15
β-strand	484-485	2	2
β-strand	488-489	2	2
α-helix	490-506	17
α-helix	512-519	8
α-helix	526-529	4
α-helix	564-578	15
α-helix	579-581	3
α-helix	585-596	12
α-helix	610-613	4
α-helix	620-636	17

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
DrrA	A, B	protein	336	Legionella pneumophila	Q5ZSQ3 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>3L0M_1 DrrA (chains A, B)
GPLGSMPYSDAKAMLDEVAKIRELGVQRVTRIENLENAKKLWDNANSMLEKGNISGYLKA
ANELHKFMKEKNLKEDDLRPELSDKTISPKGYAILQSLWGAASDYSRAAATLTESTVEPG
LVSAVNKMSAFFMDCKLSPNERATPDPDFKVGKSKILVGIMQFIKDVADPTSKIWMHNTK
ALMNHKIAAIQKLERSNNVNDETLESVLSSKGENLSEYLSYKYATKDEGREHRYTASTEN
FKNVKEKYQQMRGDALKTEILADFKDKLAEATDEQSLKQIVAELKSKDEYRILAKGQGLT
TQLLGLKTSSVSSFEKMVEETRESIKSQERQTIKIK

Primary citation

Structural mechanism of host Rab1 activation by the bifunctional Legionella type IV effector SidM/DrrA. Zhu, Y., Hu, L., Zhou, Y. et al. Proc Natl Acad Sci U S A (2010) 107:4699-4704. DOI 10.1073/pnas.0914231107 · PubMed

Other PDB entries of the same protein (UniProt Q5ZSQ3 (AlphaFold model), which also has an AlphaFold model), best resolution first:

2WWX 1.5 Å, Crystal structure of the SidM/DrrA(GEF/GDF domain)-Rab1(GTPase domain) complex
3JZ9 1.8 Å, Crystal structure of the GEF domain of DrrA/SidM from Legionella pneumophila
3JZA 1.8 Å, Crystal structure of human Rab1b in complex with the GEF domain of DrrA/SidM from…
4MXP 1.83 Å, Structural Basis for PI(4)P-Specific Membrane Recruitment of the Legionella pneumophila…
3N6O 2.5 Å, Crystal structure of the GEF and P4M domain of DrrA/SidM from Legionella pneumophila
3L0I 2.85 Å, Complex structure of SidM/DrrA with the wild type Rab1

Browse structure collections

About this viewer

MolViewer shows 3L0M directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.