3L1G: Human AlphaB crystallin

Human AlphaB crystallin. Determined by X-ray diffraction at 3.32 Å resolution. Released 12 May 2010.

Method: X-ray diffraction
Resolution: 3.32 Å
Organism: Homo sapiens
Chains: 1
Atoms: 759
Mol. weight: 11.12 kDa
Released: 12 May 2010

Explore 3L1G in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

3L1G contains 3 α-helices and 9 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 3 helices, 9 β-strands

Element	Residues	Length	Sheet
β-strand	70	1	1
β-strand	74-80	7	1
α-helix	86-88	3
β-strand	90-94	5	2
β-strand	97-101	5	2
β-strand	103	1	3
α-helix	107-109	3
β-strand	117	1	3
β-strand	120-123	4	2
α-helix	124-125	2
β-strand	135-138	4	1
β-strand	142-148	7	1

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Alpha-crystallin B chain	A	protein	96	Homo sapiens	P02511 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>3L1G_1 Alpha-crystallin B chain (chains A)
GMRLEKDRFSVNLDVKHFSPEELKVKVLGDVIEVHGKHEERQDEHGFISREFHRKYRIPA
DVDPLTITSSLSSDGVLTVNGPRKQVSGPERTIPIT

Primary citation

Crystal structures of truncated alphaA and alphaB crystallins reveal structural mechanisms of polydispersity important for eye lens function. Laganowsky, A., Benesch, J.L., Landau, M. et al. Protein Sci (2010) 19:1031-1043. DOI 10.1002/pro.380 · PubMed

Other PDB entries of the same protein (UniProt P02511 (AlphaFold model), which also has an AlphaFold model), best resolution first:

4M5S 1.37 Å, Human alphaB crystallin core domain in complex with C-terminal peptide
3SGP 1.4 Å, Amyloid-related segment of alphaB-crystallin residues 90-100 mutant V91L
7ROJ 1.6 Å, Amyloid-related segment of alphaB-crystallin residues 90-100 with G95W mutation
3SGM 1.7 Å, Bromoderivative-2 of amyloid-related segment of alphaB-crystallin residues 90-100
3SGS 1.7 Å, Amyloid-related segment of alphaB-crystallin residues 95-100
2Y1Y 2.0 Å, Human alphaB crystallin ACD(residues 71-157)
4M5T 2.0 Å, Disulfide trapped human alphaB crystallin core domain in complex with C-terminal peptide
3SGR 2.17 Å, Tandem repeat of amyloid-related segment of alphaB-crystallin residues 90-100 mutant V91L
2Y1Z 2.5 Å, Human alphaB Crystallin ACD R120G
3SGO 2.56 Å, Amyloid-related segment of alphaB-crystallin residues 90-100
2WJ7 2.63 Å, human alphaB crystallin
5VVV 2.8 Å, Structural Investigations of the Substrate Specificity of Human O-GlcNAcase

Browse structure collections

About this viewer

MolViewer shows 3L1G directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.