Crystal Structure of E. coli UvrD. Determined by X-ray diffraction at 1.8 Å resolution. Released 2 Feb 2011.
Explore 3LFU in 3D Show helices and sheets RCSB PDB PDBe
3LFU contains 40 α-helices and 22 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 4-7 | 4 | |
| α-helix | 12-18 | 7 | |
| β-strand | 25-29 | 5 | 1 |
| α-helix | 35-48 | 14 | |
| α-helix | 54-56 | 3 | |
| β-strand | 57-61 | 5 | 1 |
| α-helix | 64-78 | 15 | |
| β-strand | 86-89 | 4 | 1 |
| α-helix | 90-100 | 11 | |
| α-helix | 103-105 | 3 | |
| β-strand | 112-114 | 3 | 2 |
| α-helix | 116-129 | 14 | |
| α-helix | 139-151 | 13 | |
| α-helix | 154-156 | 3 | |
| α-helix | 166-184 | 19 | |
| β-strand | 186-188 | 3 | 2 |
| α-helix | 189-202 | 14 | |
| α-helix | 204-213 | 10 | |
| β-strand | 216-219 | 4 | 1 |
| α-helix | 222-224 | 3 | |
| α-helix | 227-237 | 11 | |
| β-strand | 242-247 | 6 | 1 |
| α-helix | 249-251 | 3 | |
| α-helix | 255-257 | 3 | |
| α-helix | 263-270 | 8 | |
| β-strand | 275-279 | 5 | 1 |
| β-strand | 281 | 1 | 3 |
| α-helix | 287-297 | 11 | |
| β-strand | 309 | 1 | 3 |
| α-helix | 316-317 | 2 | |
| β-strand | 318-325 | 8 | 4 |
| α-helix | 326-342 | 17 | |
| α-helix | 347-349 | 3 | |
| β-strand | 350-354 | 5 | 4 |
| α-helix | 357-359 | 3 | |
| α-helix | 360-369 | 10 | |
| β-strand | 374-376 | 3 | 4 |
| α-helix | 382-384 | 3 | |
| α-helix | 386-399 | 14 | |
| α-helix | 404-410 | 7 | |
| α-helix | 420-432 | 13 | |
| α-helix | 437-446 | 10 | |
| α-helix | 452-471 | 20 | |
| α-helix | 477-487 | 11 | |
| α-helix | 490-495 | 6 | |
| α-helix | 500-519 | 20 | |
| α-helix | 530-540 | 11 | |
| β-strand | 554-558 | 5 | 4 |
| α-helix | 560-562 | 3 | |
| β-strand | 567-572 | 6 | 4 |
| β-strand | 576 | 1 | 5 |
| β-strand | 578 | 1 | 6 |
| β-strand | 582 | 1 | 6 |
| α-helix | 592-603 | 12 | |
| β-strand | 606-620 | 15 | 4 |
| β-strand | 623-626 | 4 | 4 |
| α-helix | 628 | 1 | |
| β-strand | 629 | 1 | 5 |
| α-helix | 630 | 1 | |
| α-helix | 631-635 | 5 | |
| α-helix | 638-640 | 3 | |
| β-strand | 641-643 | 3 | 4 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| DNA helicase II | A | protein | 647 | Escherichia coli | P03018 (AlphaFold model) |
>3LFU_1 DNA helicase II (chains A) MDVSYLLDSLNDKQREAVAAPRSNLLVLAGAGSGKTRVLVHRIAWLMSVENCSPYSIMAV TFTNKAAAEMRHRIGQLMGTSQGGMWVGTFHGLAHRLLRAHHMDANLPQDFQILDSEDQL RLLKRLIKAMNLDEKQWPPRQAMWYINSQKDEGLRPHHIQSYGNPVEQTWQKVYQAYQEA CDRAGLVDFAELLLRAHELWLNKPHILQHYRERFTNILVDEFQDTNNIQYAWIRLLAGDT GKVMIVGDDDQSIYGWRGAQVENIQRFLNDFPGAETIRLEQNYRSTSNILSAANALIENN NGRLGKKLWTDGADGEPISLYCAFNELDEARFVVNRIKTWQDNGGALAECAILYRSNAQS RVLEEALLQASMPYRIYGGMRFFERQEIKDALSYLRLIANRNDDAAFERVVNTPTRGIGD RTLDVVRQTSRDRQLTLWQACRELLQEKALAGRAASALQRFMELIDALAQETADMPLHVQ TDRVIKDSGLRTMYEQEKGEKGQTRIENLEELVTATRQFSYNEEDEDLMPLQAFLSHAAL EAGEGQADTWQDAVQLMTLHSAKGLEFPQVFIVGMEEGMFPSQMSLDEGGRLEEERRLAY VGVTRAMQKLTLTYAETRRLYGKEVYHRPSRFIGELPEECVEEVRLR
Rotations of the 2B sub-domain of E. coli UvrD helicase/translocase coupled to nucleotide and DNA binding. Jia, H., Korolev, S., Niedziela-Majka, A. et al. J Mol Biol (2011) 411:633-648. DOI 10.1016/j.jmb.2011.06.019 · PubMed
Other PDB entries of the same protein (UniProt P03018 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 3LFU directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.