3LK2: CapZ

Crystal structure of CapZ bound to the uncapping motif from CARMIL. Determined by X-ray diffraction at 2.2 Å resolution. Released 7 Apr 2010.

Method: X-ray diffraction
Resolution: 2.2 Å
Organism: Gallus gallus
Chains: 3
Atoms: 4,632
Mol. weight: 66.24 kDa
Released: 7 Apr 2010

Explore 3LK2 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

3LK2 contains 25 α-helices and 23 β-strands across 3 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 10 helices, 11 β-strands

Element	Residues	Length	Sheet
α-helix	10-22	13
α-helix	24-25	2
α-helix	29-40	12
α-helix	43-60	18
β-strand	64-65	2	1
β-strand	74-75	2	1
α-helix	78-80	3
β-strand	81-83	3	2
β-strand	86-89	4	2
β-strand	94-99	6	2
β-strand	104-110	7	2
α-helix	118-135	18
β-strand	140-148	9	3
β-strand	151-164	14	3
α-helix	165-167	3
β-strand	169-180	12	3
β-strand	185-198	14	3
β-strand	202-217	16	3
α-helix	221-249	29
α-helix	250-254	5
α-helix	271-274	4

Chain B: 11 helices, 12 β-strands

Element	Residues	Length	Sheet
α-helix	3-13	11
α-helix	18-20	3
α-helix	21-31	11
α-helix	33-35	3
α-helix	36-42	7
α-helix	46-47	2
β-strand	48-52	5	4
β-strand	57-61	5	4
α-helix	63-65	3
β-strand	66-67	2	5
β-strand	70-72	3	5
β-strand	79-80	2	5
α-helix	91-112	22
β-strand	116-124	9	3
β-strand	127-137	11	3
β-strand	144-158	15	3
β-strand	164-179	16	3
β-strand	187-202	16	3
β-strand	204	1	6
β-strand	207	1	6
α-helix	209-228	20
α-helix	229-235	7
α-helix	236-242	7

Chain T: 4 helices, 0 β-strands

Element	Residues	Length
α-helix	973-975	3
α-helix	981-983	3
α-helix	985-988	4
α-helix	990-991	2

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
F-actin-capping protein subunit alpha-1	A	protein	286	Gallus gallus	P13127 (AlphaFold model)
F-actin-capping protein subunit beta isoforms 1 and 2	B	protein	243	Gallus gallus	P14315 (AlphaFold model)
Leucine-rich repeat-containing protein 16A	T	protein	52		Q5VZK9 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>3LK2_1 F-actin-capping protein subunit alpha-1 (chains A)
MADFEDRVSDEEKVRIAAKFITHAPPGEFNEVFNDVRLLLNNDNLLREGAAHAFAQYNMD
QFTPVKIEGYDDQVLITEHGDLGNGRFLDPRNKISFKFDHLRKEASDPQPEDTESALKQW
RDACDSALRAYVKDHYPNGFCTVYGKSIDGQQTIIACIESHQFQPKNFWNGRWRSEWKFT
ITPPTAQVAAVLKIQVHYYEDGNVQLVSHKDIQDSVQVSSDVQTAKEFIKIIENAENEYQ
TAISENYQTMSDTTFKALRRQLPVTRTKIDWNKILSYKIGKEMQNA

Sequence of entity 2 (B), FASTA

>3LK2_2 F-actin-capping protein subunit beta isoforms 1 and 2 (chains B)
MSDQQLDCALDLMRRLPPQQIEKNLSDLIDLVPSLCEDLLSSVDQPLKIARDKVVGKDYL
LCDYNRDGDSYRSPWSNKYDPPLEDGAMPSARLRKLEVEANNAFDQYRDLYFEGGVSSVY
LWDLDHGFAGVILIKKAGDGSKKIKGCWDSIHVVEVQEKSSGRTAHYKLTSTVMLWLQTN
KTGSGTMNLGGSLTRQMEKDETVSDSSPHIANIGRLVEDMENKIRSTLNEIYFGKTKDIV
NGL

Sequence of entity 3 (T), FASTA

>3LK2_3 Leucine-rich repeat-containing protein 16A (chains T)
LRQEKRSSGFISELPSEEGKKLEHFTKLRPKRNKKQQPTQAAVCAANIVSQD

Primary citation

Structural characterization of a capping protein interaction motif defines a family of actin filament regulators. Hernandez-Valladares, M., Kim, T., Kannan, B. et al. Nat Struct Mol Biol (2010) 17:497-503. DOI 10.1038/nsmb.1792 · PubMed

Other PDB entries of the same protein (UniProt P13127 (AlphaFold model), which also has an AlphaFold model), best resolution first:

7DS6 1.69 Å, Crystal structure of actin capping protein in complex with twinflin-1/CD2AP CPI chimera…
3AA0 1.7 Å, Crystal structure of Actin Capping Protein in complex with the Cp-binding motif derived…
7DS4 1.85 Å, Crystal structure of actin capping protein in complex with twinflin-1 C-terminus tail…
3AA1 1.9 Å, Crystal structure of Actin capping protein in complex with the Cp-binding motif derived…
3AA6 1.9 Å, Crystal structure of Actin capping protein in complex with the Cp-binding motif derived…
3AA7 1.9 Å, Crystal structure of Actin capping protein
7DS2 1.95 Å, Crystal structure of actin capping protein in complex with twinflin-1 C-terminus tail
7DS8 1.95 Å, Crystal structure of actin capping protein in complex with twinflin-1/CD2AP CPI chimera…
3LK4 1.99 Å, Crystal structure of CapZ bound to the uncapping motif from CD2AP
9BLI 2.0 Å, Crystal structure of Actin capping protein in complex with a fragment of Legionella…
7DS3 2.09 Å, Crystal structure of actin capping protein in complex with twinflin-2 C-terminus tail
1IZN 2.1 Å, Crystal Structure of Actin Filament Capping Protein CapZ

Browse structure collections

About this viewer

MolViewer shows 3LK2 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.