3LK3: CapZ

Crystal structure of CapZ bound to the CPI and CSI uncapping motifs from CARMIL. Determined by X-ray diffraction at 2.68 Å resolution. Released 7 Apr 2010.

Method: X-ray diffraction
Resolution: 2.68 Å
Organisms: Gallus gallus, Homo sapiens
Chains: 3
Atoms: 4,604
Mol. weight: 77.39 kDa
Released: 7 Apr 2010

Explore 3LK3 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

3LK3 contains 29 α-helices and 22 β-strands across 3 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 12 helices, 12 β-strands

Element	Residues	Length	Sheet
α-helix	10-22	13
α-helix	24-25	2
α-helix	29-40	12
α-helix	43-49	7
α-helix	51-61	11
β-strand	64-65	2	1
α-helix	66-67	2
β-strand	74-75	2	1
β-strand	81-83	3	2
β-strand	86-89	4	2
β-strand	94-99	6	2
β-strand	104-110	7	2
α-helix	118-135	18
β-strand	139-148	10	3
β-strand	151-164	14	3
α-helix	165-167	3
β-strand	169-182	14	3
β-strand	185-198	14	3
β-strand	202	1	3
β-strand	204-217	14	3
α-helix	221-249	29
α-helix	250-254	5
α-helix	255-258	4
α-helix	271-274	4

Chain B: 13 helices, 10 β-strands

Element	Residues	Length	Sheet
α-helix	3-12	10
α-helix	18-20	3
α-helix	21-31	11
α-helix	33-35	3
α-helix	36-42	7
β-strand	48-52	5	4
α-helix	53-55	3
β-strand	57-61	5	4
α-helix	63-65	3
β-strand	66-67	2	5
β-strand	70-72	3	5
β-strand	79-80	2	5
α-helix	91-112	22
β-strand	116-124	9	3
β-strand	127-137	11	3
α-helix	141-143	3
β-strand	145-158	14	3
β-strand	164-181	18	3
β-strand	185-202	18	3
α-helix	209-230	22
α-helix	231-235	5
α-helix	236-243	8
α-helix	248-249	2

Chain T: 4 helices, 0 β-strands

Element	Residues	Length
α-helix	973-975	3
α-helix	981-983	3
α-helix	985-987	3
α-helix	1026-1029	4

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
F-actin-capping protein subunit alpha-1	A	protein	286	Gallus gallus	P13127 (AlphaFold model)
F-actin-capping protein subunit beta isoforms 1 and 2	B	protein	277	Gallus gallus	P14315 (AlphaFold model)
Leucine-rich repeat-containing protein 16A	T	protein	115	Homo sapiens	Q5VZK9 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>3LK3_1 F-actin-capping protein subunit alpha-1 (chains A)
MADFEDRVSDEEKVRIAAKFITHAPPGEFNEVFNDVRLLLNNDNLLREGAAHAFAQYNMD
QFTPVKIEGYDDQVLITEHGDLGNGRFLDPRNKISFKFDHLRKEASDPQPEDTESALKQW
RDACDSALRAYVKDHYPNGFCTVYGKSIDGQQTIIACIESHQFQPKNFWNGRWRSEWKFT
ITPPTAQVAAVLKIQVHYYEDGNVQLVSHKDIQDSVQVSSDVQTAKEFIKIIENAENEYQ
TAISENYQTMSDTTFKALRRQLPVTRTKIDWNKILSYKIGKEMQNA

Sequence of entity 2 (B), FASTA

>3LK3_2 F-actin-capping protein subunit beta isoforms 1 and 2 (chains B)
MSDQQLDCALDLMRRLPPQQIEKNLSDLIDLVPSLCEDLLSSVDQPLKIARDKVVGKDYL
LCDYNRDGDSYRSPWSNKYDPPLEDGAMPSARLRKLEVEANNAFDQYRDLYFEGGVSSVY
LWDLDHGFAGVILIKKAGDGSKKIKGCWDSIHVVEVQEKSSGRTAHYKLTSTVMLWLQTN
KTGSGTMNLGGSLTRQMEKDETVSDSSPHIANIGRLVEDMENKIRSTLNEIYFGKTKDIV
NGLRSIDAIPDNQKYKQLQRELSQVLTQRQIYIQPDN

Sequence of entity 3 (T), FASTA

>3LK3_3 Leucine-rich repeat-containing protein 16A (chains T)
EKRSSGFISELPSEEGKKLEHFTKLRPKRNKKQQPTQAAVCAANIVSQDGEQNGLMGRVD
EGVDEFFTKKVTKMDSKKWSTRGSESHELNEGGDEKKKRDSRKSSGFLNLIKSRS

Primary citation

Structural characterization of a capping protein interaction motif defines a family of actin filament regulators. Hernandez-Valladares, M., Kim, T., Kannan, B. et al. Nat Struct Mol Biol (2010) 17:497-503. DOI 10.1038/nsmb.1792 · PubMed

Other PDB entries of the same protein (UniProt P13127 (AlphaFold model), which also has an AlphaFold model), best resolution first:

7DS6 1.69 Å, Crystal structure of actin capping protein in complex with twinflin-1/CD2AP CPI chimera…
3AA0 1.7 Å, Crystal structure of Actin Capping Protein in complex with the Cp-binding motif derived…
7DS4 1.85 Å, Crystal structure of actin capping protein in complex with twinflin-1 C-terminus tail…
3AA1 1.9 Å, Crystal structure of Actin capping protein in complex with the Cp-binding motif derived…
3AA6 1.9 Å, Crystal structure of Actin capping protein in complex with the Cp-binding motif derived…
3AA7 1.9 Å, Crystal structure of Actin capping protein
7DS2 1.95 Å, Crystal structure of actin capping protein in complex with twinflin-1 C-terminus tail
7DS8 1.95 Å, Crystal structure of actin capping protein in complex with twinflin-1/CD2AP CPI chimera…
3LK4 1.99 Å, Crystal structure of CapZ bound to the uncapping motif from CD2AP
9BLI 2.0 Å, Crystal structure of Actin capping protein in complex with a fragment of Legionella…
7DS3 2.09 Å, Crystal structure of actin capping protein in complex with twinflin-2 C-terminus tail
1IZN 2.1 Å, Crystal Structure of Actin Filament Capping Protein CapZ

Browse structure collections

About this viewer

MolViewer shows 3LK3 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.