3LQM: IL-10R2 Common Chain

Structure of the IL-10R2 Common Chain. Determined by X-ray diffraction at 2.14 Å resolution. Released 26 May 2010.

Method: X-ray diffraction
Resolution: 2.14 Å
Organism: Homo sapiens
Chains: 2
Atoms: 3,551
Mol. weight: 48.22 kDa
Released: 26 May 2010

Explore 3LQM in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

3LQM contains 18 α-helices and 38 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 9 helices, 19 β-strands

Element	Residues	Length	Sheet
α-helix	22-24	3
β-strand	25-32	8	1
β-strand	35-41	7	1
α-helix	42-44	3
β-strand	51-58	8	2
β-strand	61-69	9	2
β-strand	73-75	3	1
β-strand	85-93	9	2
β-strand	96-97	2	2
β-strand	101-105	5	2
α-helix	107-110	4
β-strand	112	1	1
α-helix	114-116	3
β-strand	117-123	7	3
β-strand	126-132	7	3
α-helix	133-134	2
β-strand	135-137	3	4
β-strand	142-144	3	4
α-helix	145-148	4
β-strand	153-160	8	5
β-strand	167-169	3	5
β-strand	175-178	4	3
α-helix	181-182	2
β-strand	186-195	10	5
β-strand	200-201	2	5
α-helix	203-207	5
β-strand	208-211	4	5
α-helix	215-217	3

Chain B: 9 helices, 19 β-strands

Element	Residues	Length	Sheet
α-helix	22-24	3
β-strand	25-32	8	6
β-strand	35-41	7	6
α-helix	42-44	3
β-strand	51-58	8	7
β-strand	61-69	9	7
β-strand	73-75	3	6
β-strand	85-93	9	7
β-strand	96-97	2	7
β-strand	101-105	5	7
α-helix	107-110	4
β-strand	112	1	6
α-helix	115-116	2
β-strand	117-122	6	8
β-strand	127-132	6	8
α-helix	133-134	2
β-strand	135	1	9
β-strand	144	1	9
α-helix	145-148	4
β-strand	153-160	8	10
β-strand	166-169	4	10
β-strand	175-178	4	8
α-helix	181-182	2
β-strand	186-195	10	10
α-helix	196-198	3
β-strand	200-201	2	10
α-helix	203-207	5
β-strand	208-211	4	10

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Interleukin-10 receptor subunit beta	A, B	protein	201	Homo sapiens	Q08334 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>3LQM_1 Interleukin-10 receptor subunit beta (chains A, B)
MVPPPENVRMNSVNFKNILQWESPAFAKGQLTFTAQYLSYRIFQDKCMQTTLTECDFSSL
SKYGDHTLRVRAEFADEHSDWVQITFSPVDDTIIGPPGMQVEVLADCLHMRFLAPKIENE
YETWTMKNVYNSWTYNVQYWKQGTDEKFQITPQYDFEVLRNLEPWTTYCVQVRGFLPDRN
KAGEWSEPVCEQTTHDETVPS

Primary citation

Structure and mechanism of receptor sharing by the IL-10R2 common chain. Yoon, S.I., Jones, B.C., Logsdon, N.J. et al. Structure (2010) 18:638-648. DOI 10.1016/j.str.2010.02.009 · PubMed

Other PDB entries of the same protein (UniProt Q08334 (AlphaFold model), which also has an AlphaFold model), best resolution first:

5T5W 2.85 Å, Structure of an affinity matured lambda-IFN/IFN-lambdaR1/IL-10Rbeta receptor complex
9BPV 3.0 Å, Structure of the IFN-lambda3/IFN-lambdaR1/IL-10Rbeta receptor complex with an engineered…
9BPU 3.26 Å, Structure of the IFN-lambda4/IFN-lambdaR1/IL-10Rbeta receptor complex with an engineered…
6X93 3.5 Å, Interleukin-10 signaling complex with IL-10RA and IL-10RB

Browse structure collections

About this viewer

MolViewer shows 3LQM directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.