3MU6: Myocyte-specific enhancer factor 2A

Inhibiting the Binding of Class IIa Histone Deacetylases to Myocyte Enhancer Factor-2 by Small Molecules. Determined by X-ray diffraction at 2.43 Å resolution. Released 2 Nov 2011.

Method: X-ray diffraction
Resolution: 2.43 Å
Organism: Homo sapiens
Chains: 8
Atoms: 3,751
Mol. weight: 54.77 kDa
Ligands: BXL
Released: 2 Nov 2011

Explore 3MU6 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

3MU6 contains 8 α-helices and 8 β-strands across 4 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 2 helices, 2 β-strands

Element	Residues	Length	Sheet
α-helix	14-39	26
β-strand	42-48	7	1
β-strand	54-58	5	1
α-helix	62-70	9

Chains B, C and D: 2 helices, 2 β-strands

Element	Residues	Length	Sheet
α-helix	14-39	26
β-strand	42-48	7	1
β-strand	54-58	5	1
α-helix	62-71	10

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Myocyte-specific enhancer factor 2A	A, B, C, D	protein	71	Homo sapiens	Q02078 (AlphaFold model)
DNA (5'-d(apapapgpcptpaptptpaptptpapgpcptp*t)-3')	E, G	DNA	17
DNA (5'-d(tpapapgpcptpapaptpapaptpapgpcptp*t)-3')	F, H	DNA	17

Sequence of entity 1 (A, B, C, D), FASTA

>3MU6_1 Myocyte-specific enhancer factor 2A (chains A, B, C, D)
GRKKIQITRIMDERNRQVTFTKRKFGLMKKAYELSVLCDCEIALIIFNSSNKLFQYASTD
MDKVLLKYTAY

Sequence of entity 2 (E, G), FASTA

>3MU6_2 DNA (5'-D(*AP*AP*AP*GP*CP*TP*AP*TP*TP*AP*TP*TP*AP*GP*CP*TP*T)-3') (chains E, G)
AAAGCTATTATTAGCTT

Sequence of entity 3 (F, H), FASTA

>3MU6_3 DNA (5'-D(*TP*AP*AP*GP*CP*TP*AP*AP*TP*AP*AP*TP*AP*GP*CP*TP*T)-3') (chains F, H)
TAAGCTAATAATAGCTT

Ligands and cofactors

ID	Name	Formula	Copies
BXL	(3E)-N~8~-(2-aminophenyl)-N~1~-phenyloct-3-enediamide	C20 H23 N3 O2	1

Primary citation

Inhibition of the function of class IIa HDACs by blocking their interaction with MEF2. Jayathilaka, N., Han, A., Gaffney, K.J. et al. Nucleic Acids Res (2012) 40:5378-5388. DOI 10.1093/nar/gks189 · PubMed

Other PDB entries of the same protein (UniProt Q02078 (AlphaFold model), which also has an AlphaFold model), best resolution first:

1EGW 1.5 Å, Crystal structure of MEF2A core bound to DNA
6WC2 2.1 Å, Crystal Structure of a Ternary MEF2 Chimera/NKX2-5/myocardin enhancer DNA Complex
3P57 2.19 Å, Crystal structure of the p300 TAZ2 domain bound to MEF2 on DNA
1LEW 2.3 Å, Crystal structure of map kinase P38 complexed to the docking site on its nuclear…
6BYY 2.3 Å, MEF2 CHIMERA/DNA Complex
3KOV 2.9 Å, Structure of MEF2A bound to DNA reveals a completely folded MADS-box/MEF2 domain that…
6BZ1 2.97 Å, MEF2 Chimera D83V mutant/DNA complex
7XUZ 3.59 Å, Crystal structure of a HDAC4-MEF2A-DNA ternary complex
1C7U Complex of the DNA binding core domain of the transcription factor MEF2A with a 20mer…

Browse structure collections

About this viewer

MolViewer shows 3MU6 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.