3N6O: Guanine nucleotide exchange factor

Crystal structure of the GEF and P4M domain of DrrA/SidM from Legionella pneumophila. Determined by X-ray diffraction at 2.5 Å resolution. Released 28 Jul 2010.

Method: X-ray diffraction
Resolution: 2.5 Å
Organism: Legionella pneumophila
Chains: 2
Atoms: 4,966
Mol. weight: 71.02 kDa
Released: 28 Jul 2010

Explore 3N6O in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

3N6O contains 33 α-helices and 4 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 17 helices, 2 β-strands

Element	Residues	Length	Sheet
α-helix	342-362	21
α-helix	365-381	17
α-helix	386-389	4
α-helix	390-393	4
α-helix	400-419	20
α-helix	428-445	18
α-helix	452-454	3
α-helix	464-478	15
β-strand	484-485	2	1
β-strand	488-489	2	1
α-helix	490-506	17
α-helix	512-520	9
α-helix	526-529	4
α-helix	557-559	3
α-helix	564-579	16
α-helix	585-596	12
α-helix	599-605	7
α-helix	610-615	6
α-helix	620-634	15

Chain B: 16 helices, 2 β-strands

Element	Residues	Length	Sheet
α-helix	338-362	25
α-helix	365-381	17
α-helix	386-389	4
α-helix	390-393	4
α-helix	400-419	20
α-helix	428-447	20
α-helix	464-478	15
β-strand	484-485	2	2
β-strand	488-489	2	2
α-helix	490-506	17
α-helix	512-520	9
α-helix	526-529	4
α-helix	557-559	3
α-helix	564-579	16
α-helix	585-596	12
α-helix	599-605	7
α-helix	610-615	6
α-helix	620-634	15

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
guanine nucleotide exchange factor	A, B	protein	311	Legionella pneumophila	Q5ZSQ3 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>3N6O_1 guanine nucleotide exchange factor (chains A, B)
GHMVTRIENLENAKKLWDNANSMLEKGNISGYLKAANELHKFMKEKNLKEDDLRPELSDK
TISPKGYAILQSLWGAASDYSRAAATLTESTVEPGLVSAVNKMSAFFMDCKLSPNERATP
DPDFKVGKSKILVGIMQFIKDVADPTSKIWMHNTKALMNHKIAAIQKLERSNNVNDETLE
SVLSSKGENLSEYLSYKYATKDEGREHRYTASTENFKNVKEKYQQMRGDALKTEILADFK
DKLAEATDEQSLKQIVAELKSKDEYRILAKGQGLTTQLLGLKTSSVSSFEKMVEETRESI
KSQERQTIKIK

Primary citation

High-affinity binding of phosphatidylinositol 4-phosphate by Legionella pneumophila DrrA. Schoebel, S., Blankenfeldt, W., Goody, R.S. et al. EMBO Rep (2010) 11:598-604. DOI 10.1038/embor.2010.97 · PubMed

Other PDB entries of the same protein (UniProt Q5ZSQ3 (AlphaFold model), which also has an AlphaFold model), best resolution first:

2WWX 1.5 Å, Crystal structure of the SidM/DrrA(GEF/GDF domain)-Rab1(GTPase domain) complex
3JZ9 1.8 Å, Crystal structure of the GEF domain of DrrA/SidM from Legionella pneumophila
3JZA 1.8 Å, Crystal structure of human Rab1b in complex with the GEF domain of DrrA/SidM from…
4MXP 1.83 Å, Structural Basis for PI(4)P-Specific Membrane Recruitment of the Legionella pneumophila…
3L0I 2.85 Å, Complex structure of SidM/DrrA with the wild type Rab1
3L0M 3.45 Å, Crystal structure of Rab1-activation domain and P4M domain of SidM/DrrA from legionella

Browse structure collections

About this viewer

MolViewer shows 3N6O directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.