3NFI: DNA-directed RNA polymerase I subunit RPA49

Crystal structure of tandem winged helix domain of RNA polymerase I subunit A49. Determined by X-ray diffraction at 1.9 Å resolution. Released 8 Sept 2010.

Method

X-ray diffraction

Resolution

1.9 Å

Organism

Saccharomyces cerevisiae

Chains

5

Atoms

9,695

Mol. weight

136.06 kDa

Ligands

PE4

Released

8 Sept 2010

Explore 3NFI in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

3NFI contains 92 α-helices and 30 β-strands across 5 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 19 helices, 7 β-strands

Molecules and chains

>3NFI_1 DNA-directed RNA polymerase I subunit RPA49 (chains A, B, C, D, E)
GSHMDLPTRAQMDEITSNDRPTPLANIDATDVEQIYPIESIIPKKELQFIRVSSILKEAD
KEKKLELFPYQNNSKYVAKKLDSLTQPSQMTKLQMLYYLSLLLGVYENRRVNNKTKLLER
LNSPPEILVDGILSRFTVIKPGQFGRSKDRSYFIDPQNEDKILCYILAIIMHLDNFIVEI
TPLAHELNLKPSKVVSLFRVLGAIVKGATVAQAEAFGIPKSTAASYKIATMKVPFKL

Ligands and cofactors

Primary citation

RNA Polymerase I Contains a TFIIF-Related DNA-Binding Subcomplex. Geiger, S.R., Lorenzen, K., Schreieck, A. et al. Mol Cell (2010) 39:583-594. DOI 10.1016/j.molcel.2010.07.028 · PubMed

Related structures

Other PDB entries of the same protein (UniProt Q01080 (AlphaFold model), which also has an AlphaFold model), best resolution first:

• 3NFH 2.17 Å, Crystal structure of tandem winged helix domain of RNA polymerase I subunit A49 (P4)
• 6RUI 2.7 Å, RNA Polymerase I Pre-initiation complex DNA opening intermediate 2
• 9G1V 2.7 Å, Yeast RNA polymerase I elongation complex stalled by an apurinic site
• 4C2M 2.8 Å, Structure of RNA polymerase I at 2.8 A resolution
• 6RQL 2.9 Å, RNA Polymerase I Closed Conformation 2 (CC2)
• 4C3I 3.0 Å, Structure of 14-subunit RNA polymerase I at 3.0 A resolution, crystal form C2-100
• 6RWE 3.0 Å, RNA Polymerase I Open Complex conformation 2
• 6RRD 3.1 Å, RNA Polymerase I Pre-initiation complex DNA opening intermediate 1
• 4C3H 3.27 Å, Structure of 14-subunit RNA polymerase I at 3.27 A resolution, crystal form C2-93
• 9G29 3.3 Å, Yeast RNA polymerase I elongation complex stalled by an apurinic site with the…
• 4C3J 3.35 Å, Structure of 14-subunit RNA polymerase I at 3.35 A resolution, crystal form C2-90
• 5N61 3.4 Å, RNA polymerase I initially transcribing complex

Browse structure collections

About this viewer

MolViewer shows 3NFI directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.