Crystal structure of insulin-like growth factor 1 receptor (IGF-1R-WT) complex with a carbon-linked proline isostere inhibitor (34). Determined by X-ray diffraction at 2.11 Å resolution. Released 28 Jul 2010.
Explore 3NW7 in 3D Show helices and sheets RCSB PDB PDBe
3NW7 contains 21 α-helices and 12 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 963 | 1 | 1 |
| α-helix | 966-968 | 3 | |
| β-strand | 969-977 | 9 | 1 |
| β-strand | 982-988 | 7 | 1 |
| β-strand | 998-1004 | 7 | 1 |
| α-helix | 1011-1021 | 11 | |
| α-helix | 1022-1026 | 5 | |
| β-strand | 1032 | 1 | 2 |
| α-helix | 1033-1034 | 2 | |
| β-strand | 1035-1039 | 5 | 1 |
| β-strand | 1046-1050 | 5 | 1 |
| β-strand | 1056 | 1 | 2 |
| α-helix | 1057-1063 | 7 | |
| α-helix | 1074-1078 | 5 | |
| α-helix | 1079-1098 | 20 | |
| α-helix | 1108-1110 | 3 | |
| β-strand | 1111-1113 | 3 | 2 |
| β-strand | 1119-1121 | 3 | 2 |
| α-helix | 1132-1134 | 3 | |
| β-strand | 1136 | 1 | 3 |
| β-strand | 1144 | 1 | 3 |
| α-helix | 1146-1148 | 3 | |
| α-helix | 1151-1156 | 6 | |
| α-helix | 1161-1177 | 17 | |
| α-helix | 1180-1181 | 2 | |
| α-helix | 1188-1196 | 9 | |
| α-helix | 1201-1204 | 4 | |
| α-helix | 1209-1218 | 10 | |
| α-helix | 1223-1225 | 3 | |
| α-helix | 1227-1228 | 2 | |
| α-helix | 1229-1236 | 8 | |
| α-helix | 1237-1239 | 3 | |
| α-helix | 1244-1247 | 4 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Insulin-like growth factor 1 receptor | A | protein | 307 | Homo sapiens | P08069 (AlphaFold model) |
>3NW7_1 Insulin-like growth factor 1 receptor (chains A) MVSAADVYVPDEWEVAREKITMSRELGQGSFGMVYEGVAKGVVKDEPETRVAIKTVNEAA SMRERIEFLNEASVMKEFNCHHVVRLLGVVSQGQPTLVIMELMTRGDLKSYLRSLRPEME NNPVLAPPSLSKMIQMAGEIADGMAYLNANKFVHRDLAARNCMVAEDFTVKIGDFGMTRD IYETDYYRKGGKGLLPVRWMSPESLKDGVFTTYSDVWSFGVVLWEIATLAEQPYQGLSNE QVLRFVMEGGLLDKPDNCPDMLFELMRMCWQYNPKMRPSFLEIISSIKEEMEPGFREVSF YYSEENK
| ID | Name | Formula | Copies |
|---|---|---|---|
| LGV | N-({4-[(3-cyclopropyl-1H-pyrazol-5-yl)amino]pyrrolo[2,1-f][1,2,4]triazin-2-yl}m… | C19 H17 F N8 O | 1 |
Proline isosteres in a series of 2,4-disubstituted pyrrolo[1,2-f][1,2,4]triazine inhibitors of IGF-1R kinase and IR kinase. Sampognaro, A.J., Wittman, M.D., Carboni, J.M. et al. Bioorg Med Chem Lett (2010) 20:5027-5030. DOI 10.1016/j.bmcl.2010.07.045 · PubMed
Other PDB entries of the same protein (UniProt P08069 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 3NW7 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.