3O23: Human unphosphorylated IGF1-R Kinase domain

Human unphosphorylated IGF1-R Kinase domain in complex with an hydantoin inhibitor. Determined by X-ray diffraction at 2.1 Å resolution. Released 4 May 2011.

Method: X-ray diffraction
Resolution: 2.1 Å
Organism: Homo sapiens
Chains: 1
Atoms: 2,459
Mol. weight: 35.26 kDa
Ligands: MQY
Released: 4 May 2011

Explore 3O23 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

3O23 contains 18 α-helices and 12 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 18 helices, 12 β-strands

Element	Residues	Length	Sheet
β-strand	993	1	1
α-helix	996-998	3
β-strand	999-1007	9	1
β-strand	1012-1019	8	1
β-strand	1027-1034	8	1
α-helix	1041-1054	14
β-strand	1062	1	2
α-helix	1063-1064	2
β-strand	1065-1069	5	1
β-strand	1076-1080	5	1
β-strand	1086	1	2
α-helix	1087-1099	13
α-helix	1109-1128	20
α-helix	1138-1140	3
β-strand	1141-1143	3	2
β-strand	1149-1151	3	2
α-helix	1162-1164	3
β-strand	1166	1	3
β-strand	1174	1	3
α-helix	1181-1186	6
α-helix	1191-1207	17
α-helix	1210-1211	2
α-helix	1218-1226	9
α-helix	1231-1234	4
α-helix	1239-1248	10
α-helix	1253-1255	3
α-helix	1257-1258	2
α-helix	1259-1264	6
α-helix	1267-1269	3
α-helix	1273-1277	5

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Insulin-like growth factor 1 receptor	A	protein	305	Homo sapiens	P08069 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>3O23_1 Insulin-like growth factor 1 receptor (chains A)
SAADVFVPDEWEVAREKITMSRELGQGSFGMVYEGVAKGVVKDEPETRVAIKTVNEAASM
RERIEFLNEASVMKEFNCHHVVRLLGVVSQGQPTLVIMELMTRGDLKSYLRSLRPEMENN
PVLAPPSLSKMIQMAGEIADGMAYLNANKFVHRDLAARNCMVAEDFTVKIGDFGMTRDIY
ETDYYRKGGKGLLPVRWMSPESLKDGVFTTYSDVWSFGVVLWEIATLAEQPYQGLSNEQV
LRFVMEGGLLDKPDNCPDMLFELMRMCWQYNPKMRPSFLEIISSIKEEMEPGFREVSFYY
SEENK

Ligands and cofactors

ID	Name	Formula	Copies
MQY	(5S)-5-methyl-1-(quinolin-4-ylmethyl)-3-{4-[(trifluoromethyl)sulfonyl]phenyl}im…	C21 H16 F3 N3 O4 S	1

Primary citation

Discovery of the first non-ATP competitive IGF-1R kinase inhibitors: Advantages in comparison with competitive inhibitors. Lesuisse, D., Mauger, J., Nemecek, C. et al. Bioorg Med Chem Lett (2011) 21:2224-2228. DOI 10.1016/j.bmcl.2011.03.003 · PubMed

Other PDB entries of the same protein (UniProt P08069 (AlphaFold model), which also has an AlphaFold model), best resolution first:

1P4O 1.5 Å, Structure of Apo unactivated IGF-1R KInase domain at 1.5A resolution.
8PYN 1.71 Å, Human IGF1R with inhibitor 56
3LW0 1.79 Å, IGF-1RK in complex with ligand MSC1609119A-1
5FXS 1.9 Å, IGFR-1R complex with a pyrimidine inhibitor.
2OJ9 2.0 Å, Structure of IGF-1R kinase domain complexed with a benzimidazole inhibitor
3I81 2.08 Å, Crystal structure of insulin-like growth factor 1 receptor (IGF-1R-WT) complex with…
1JQH 2.1 Å, IGF-1 receptor kinase domain
1K3A 2.1 Å, Structure of the Insulin-like Growth Factor 1 Receptor Kinase
4D2R 2.1 Å, Human IGF in complex with a Dyrk1B inhibitor
3NW7 2.11 Å, Crystal structure of insulin-like growth factor 1 receptor (IGF-1R-WT) complex with a…
3NW5 2.14 Å, Crystal structure of insulin-like growth factor 1 receptor (IGF-1R-WT) complex with a…
3NW6 2.2 Å, Crystal structure of insulin-like growth factor 1 receptor (IGF-1R-WT) complex with a…

Browse structure collections

About this viewer

MolViewer shows 3O23 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.