Effector domain of NS1 from influenza A/PR/8/34 containing a W187A mutation. Determined by X-ray diffraction at 2.0 Å resolution. Released 11 May 2011.
Explore 3O9R in 3D Show helices and sheets RCSB PDB PDBe
3O9R contains 6 α-helices and 14 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 88-91 | 4 | 1 |
| α-helix | 95-99 | 5 | |
| β-strand | 107-112 | 6 | 1 |
| β-strand | 115-120 | 6 | 1 |
| β-strand | 127-136 | 10 | 1 |
| β-strand | 141-150 | 10 | 1 |
| β-strand | 156-162 | 7 | 1 |
| α-helix | 171-186 | 16 | |
| β-strand | 191-194 | 4 | 1 |
| α-helix | 196-201 | 6 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 88-91 | 4 | 1 |
| α-helix | 95-99 | 5 | |
| β-strand | 109-112 | 4 | 1 |
| β-strand | 115-119 | 5 | 1 |
| β-strand | 127-137 | 11 | 1 |
| β-strand | 140-151 | 12 | 1 |
| β-strand | 156-162 | 7 | 1 |
| α-helix | 171-186 | 16 | |
| β-strand | 191-194 | 4 | 1 |
| α-helix | 196-202 | 7 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Nonstructural protein 1 | A, B | protein | 152 | Influenza A virus | P03496 (AlphaFold model) |
>3O9R_1 Nonstructural protein 1 (chains A, B) MTMASVPASRYLTDMTLEEMSRDWSMLIPKQKVAGPLCIRMDQAIMDKNIILKANFSVIF DRLETLILLRAFTEEGAIVGEISPLPSLPGHTAEDVKNAVGVLIGGLEANDNTVRVSETL QRFAWRSSNENGRPPLTPKQKREMAGTIRSEV
A Transient Homotypic Interaction Model for the Influenza A Virus NS1 Protein Effector Domain. Kerry, P.S., Ayllon, J., Taylor, M.A. et al. PLoS One (2011) 6:e17946-e17946. DOI 10.1371/journal.pone.0017946 · PubMed
Other PDB entries of the same protein (UniProt P03496 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 3O9R directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.