3OG7: B-Raf Kinase V600E oncogenic mutant

B-Raf Kinase V600E oncogenic mutant in complex with PLX4032. Determined by X-ray diffraction at 2.45 Å resolution. Released 22 Sept 2010.

Method: X-ray diffraction
Resolution: 2.45 Å
Organism: Homo sapiens
Chains: 2
Atoms: 4,100
Mol. weight: 66.45 kDa
Ligands: 032
Released: 22 Sept 2010

Explore 3OG7 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

3OG7 contains 25 α-helices and 22 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 12 helices, 10 β-strands

Element	Residues	Length	Sheet
β-strand	451	1	1
β-strand	458-465	8	1
β-strand	469-475	7	1
β-strand	479-485	7	1
α-helix	492-505	14
β-strand	513	1	2
β-strand	516-520	5	1
β-strand	526-530	5	1
β-strand	534-536	3	2
α-helix	537-538	2
α-helix	539-543	5
α-helix	550-569	20
α-helix	579-581	3
β-strand	582-585	4	2
β-strand	589-592	4	2
α-helix	622-625	4
α-helix	635-651	17
α-helix	662-671	10
α-helix	687-696	10
α-helix	701-703	3
α-helix	705-706	2
α-helix	707-716	10

Chain B: 13 helices, 12 β-strands

Element	Residues	Length	Sheet
β-strand	451	1	3
β-strand	458-465	8	3
β-strand	470-475	6	3
β-strand	479-485	7	3
α-helix	492-505	14
β-strand	513	1	4
β-strand	516-520	5	3
β-strand	525-530	6	3
β-strand	536	1	4
α-helix	537-541	5
α-helix	547-549	3
α-helix	550-569	20
β-strand	573	1	5
α-helix	579-581	3
β-strand	582-585	4	4
β-strand	589-592	4	4
β-strand	599	1	5
α-helix	616-619	4
α-helix	622-625	4
α-helix	635-651	17
α-helix	662-671	10
α-helix	678-680	3
α-helix	687-696	10
α-helix	701-703	3
α-helix	707-719	13

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
AKAP9-BRAF fusion protein	A, B	protein	289	Homo sapiens	P15056 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>3OG7_1 AKAP9-BRAF fusion protein (chains A, B)
MKKGHHHHHHGSRDAADDWEIPDGQITVGQRIGSGSFGTVYKGKWHGDVAVKMLNVTAPT
PQQLQAFKNEVGVLRKTRHVNILLFMGYSTAPQLAIVTQWCEGSSLYHHLHASETKFEMK
KLIDIARQTARGMDYLHAKSIIHRDLKSNNIFLHEDNTVKIGDFGLATEKSRWSGSHQFE
QLSGSILWMAPEVIRMQDSNPYSFQSDVYAFGIVLYELMTGQLPYSNINNRDQIIEMVGR
GSLSPDLSKVRSNCPKRMKRLMAECLKKKRDERPSFPRILAEIEELARE

Ligands and cofactors

ID	Name	Formula	Copies
032	N-(3-{[5-(4-chlorophenyl)-1H-pyrrolo[2,3-b]pyridin-3-yl]carbonyl}-2,4-difluorop…	C23 H18 Cl F2 N3 O3 S	1

Primary citation

Clinical efficacy of a RAF inhibitor needs broad target blockade in BRAF-mutant melanoma. Bollag, G., Hirth, P., Tsai, J. et al. Nature (2010) 467:596-599. DOI 10.1038/nature09454 · PubMed

Other PDB entries of the same protein (UniProt P15056 (AlphaFold model), which also has an AlphaFold model), best resolution first:

8VSO 1.5 Å, Ternary structure of 14-3-3 sigma, BRAF phosphopeptide (pS365) and compound 78 (1124378)
8JNB 1.62 Å, CRAF ras-binding domain chimera, ligand complex
8C7X 1.65 Å, Crystal structure of BRAF in complex with a hybrid compound 6
8C7Y 1.65 Å, Crystal structure of BRAF V600E in complex with a hybrid compound 6
9EW6 1.65 Å, Binary structure of 14-3-3s and BRAF phosphopeptide (pS365)
8JNA 1.7 Å, CRAF ras-binding domain chimera, apo form
9BP8 1.73 Å, Crystal structure of BRAF kinase domain with PF-07799933
5VYK 1.75 Å, Crystal structure of the BRS domain of BRAF in complex with the CC-SAM domain of KSR1
9BFB 1.92 Å, Crystal structure of BRAF kinase domain with PF-07284890
7K0V 1.93 Å, Crystal structure of bRaf in complex with inhibitor GNE-0749
5ITA 1.95 Å, Crystal Structure of BRAF Kinase Domain Bound to AZ-VEM
3NY5 1.99 Å, Crystal structure of the RBD domain of serine/threonine-protein kinase B-raf from Homo…

Browse more

3OG7 is part of these collections:

Kinases and cancer drug targets

About this viewer

MolViewer shows 3OG7 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.