3OLN: SRA domain of E3 ubiquitin-protein ligase UHRF2

Name: PDB 3OLN: Crystal structure of the SRA domain of E3 ubiquitin-protein ligase UHRF2
Published: 2010-10-13
License: https://creativecommons.org/publicdomain/zero/1.0/
Keywords: ligase

Crystal structure of the SRA domain of E3 ubiquitin-protein ligase UHRF2. Determined by X-ray diffraction at 2.3 Å resolution. Released 13 Oct 2010.

Method: X-ray diffraction
Resolution: 2.3 Å
Organism: Homo sapiens
Chains: 2
Atoms: 2,997
Mol. weight: 51.27 kDa
Released: 13 Oct 2010

Explore 3OLN in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

3OLN contains 15 α-helices and 18 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 8 helices, 9 β-strands

Element	Residues	Length	Sheet
α-helix	449-450	2
β-strand	458-459	2	1
α-helix	462-467	6
β-strand	478-481	4	1
β-strand	485-491	7	1
β-strand	500	1	1
β-strand	504-508	5	1
α-helix	532-540	9
β-strand	551-552	2	1
α-helix	556-558	3
α-helix	560-561	2
β-strand	562-567	6	1
α-helix	568-570	3
β-strand	582-597	16	1
β-strand	604-612	9	1
α-helix	617-618	2
α-helix	622-630	9

Chain B: 7 helices, 9 β-strands

Element	Residues	Length	Sheet
α-helix	449-450	2
β-strand	458-459	2	2
α-helix	462-467	6
β-strand	478-481	4	2
β-strand	485-491	7	2
β-strand	500	1	2
β-strand	504-508	5	2
α-helix	532-539	8
β-strand	551-552	2	2
α-helix	556-558	3
β-strand	562-567	6	2
α-helix	568-570	3
β-strand	582-597	16	2
β-strand	604-612	9	2
α-helix	617-618	2
α-helix	622-631	10

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
E3 ubiquitin-protein ligase UHRF2	A, B	protein	231	Homo sapiens	Q96PU4 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>3OLN_1 E3 ubiquitin-protein ligase UHRF2 (chains A, B)
GSTESRRDWGRGMACVGRTRECTIVPSNHYGPIPGIPVGSTWRFRVQVSEAGVHRPHVGG
IHGRSNDGAYSLVLAGGFADEVDRGDEFTYTGSGGKNLAGNKRIGAPSADQTLTNMNRAL
ALNCDAPLDDKIGAESRNWRAGKPVRVIRSFKGRKISKYAPEEGNRYDGIYKVVKYWPEI
SSSHGFLVWRYLLRRDDVEPAPWTSEGIERSRRLCLRLQYPAGYPSDKEGK

Primary citation

The Set and Ring Associated (SRA) domain of human ubiquitin-like containing PHD and RING finger domains 2 (UHRF2). Walker, J.R., Xue, S., Avvakumov, G.V. et al. To be published.

Other PDB entries of the same protein (UniProt Q96PU4 (AlphaFold model), which also has an AlphaFold model), best resolution first:

4PW7 2.0 Å, structure of UHRF2-SRA in complex with a 5mC-containing DNA
1Z6U 2.1 Å, Np95-like ring finger protein isoform b [Homo sapiens]
5YCO 2.2 Å, Complex structure of PCNA with UHRF2
4PW5 2.2 Å, structure of UHRF2-SRA in complex with a 5hmC-containing DNA, complex I
4TVR 2.29 Å, Tandem Tudor and PHD domains of UHRF2
4PW6 3.79 Å, structure of UHRF2-SRA in complex with a 5hmC-containing DNA, complex II
1WY8 Solution Structure of the N-terminal Ubiquitin-like Domain in Human Np95/ICBP90-like…
2E6S Solution structure of the PHD domain in RING finger protein 107

Browse structure collections

About this viewer

MolViewer shows 3OLN directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.