3P57: P300 TAZ2 domain
Crystal structure of the p300 TAZ2 domain bound to MEF2 on DNA. Determined by X-ray diffraction at 2.19 Å resolution. Released 10 Aug 2011.
- Method
- X-ray diffraction
- Resolution
- 2.19 Å
- Organisms
- Homo sapiens, Synthetic construct
- Chains
- 13
- Atoms
- 7,346
- Mol. weight
- 104.44 kDa
- Ligands
- ZN
- Released
- 10 Aug 2011
Explore 3P57 in 3D
Show helices and sheets
RCSB PDB
PDBe
Secondary structure: helices and β-sheets
3P57 contains 22 α-helices and 18 β-strands across 7 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
Chain A: 3 helices, 3 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 14-39 | 26 | |
| β-strand | 42-48 | 7 | 1 |
| β-strand | 54-58 | 5 | 1 |
| α-helix | 62-71 | 10 | |
| β-strand | 78-79 | 2 | 1 |
| α-helix | 81-90 | 10 | |
Chain B: 3 helices, 3 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 14-38 | 25 | |
| β-strand | 42-48 | 7 | 1 |
| β-strand | 54-58 | 5 | 1 |
| α-helix | 62-70 | 9 | |
| β-strand | 77-79 | 3 | 1 |
| α-helix | 81-90 | 10 | |
Chain C: 3 helices, 3 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 14-39 | 26 | |
| β-strand | 42-48 | 7 | 2 |
| β-strand | 54-58 | 5 | 2 |
| α-helix | 62-71 | 10 | |
| β-strand | 77-79 | 3 | 2 |
| α-helix | 81-89 | 9 | |
Chains D and J: 3 helices, 3 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 14-39 | 26 | |
| β-strand | 42-48 | 7 | 2 |
| β-strand | 54-58 | 5 | 2 |
| α-helix | 62-71 | 10 | |
| β-strand | 77-79 | 3 | 2 |
| α-helix | 81-90 | 10 | |
Chain I: 3 helices, 3 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 14-39 | 26 | |
| β-strand | 42-48 | 7 | 3 |
| β-strand | 54-58 | 5 | 3 |
| α-helix | 62-70 | 9 | |
| β-strand | 78-79 | 2 | 3 |
| α-helix | 81-89 | 9 | |
Chain P: 4 helices, 0 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 5-25 | 21 | |
| α-helix | 36-43 | 8 | |
| α-helix | 60-71 | 12 | |
| α-helix | 84-112 | 29 | |
Molecules and chains
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|
| Myocyte-specific enhancer factor 2A | A, B, C, D, I, J | protein | 90 | Homo sapiens | Q02078 (AlphaFold model) |
| DNA (5'-d(*a*ap*ap*cp*tp*ap*tp*tp*tp*ap*tp*ap*ap*gp*a)-3') | E, G, K | DNA | 15 | Synthetic construct | |
| DNA (5'-d(*tp*tp*cp*tp*tp*ap*tp*ap*ap*ap*tp*ap*gp*tp*t)-3') | F, H, L | DNA | 15 | Synthetic construct | |
| Histone acetyltransferase p300 | P | protein | 112 | Homo sapiens | Q09472 (AlphaFold model) |
Sequence of entity 1 (A, B, C, D, I, J), FASTA
>3P57_1 Myocyte-specific enhancer factor 2A (chains A, B, C, D, I, J)
GRKKIQITRIMDERNRQVTFTKRKFGLMKKAYELSVLCDCEIALIIFNSSNKLFQYASTD
MDKVLLKYTEYNEPHESRTNSDIVEALNKK
Sequence of entity 2 (E, G, K), FASTA
>3P57_2 DNA (5'-D(*A*AP*AP*CP*TP*AP*TP*TP*TP*AP*TP*AP*AP*GP*A)-3') (chains E, G, K)
AAACTATTTATAAGA
Sequence of entity 3 (F, H, L), FASTA
>3P57_3 DNA (5'-D(*TP*TP*CP*TP*TP*AP*TP*AP*AP*AP*TP*AP*GP*TP*T)-3') (chains F, H, L)
TTCTTATAAATAGTT
Sequence of entity 4 (P), FASTA
>3P57_4 Histone acetyltransferase p300 (chains P)
HMSPGDSRRLSIQRCIQSLVHACQCRNANCSLPSCQKMKRVVQHTKGCKRKTNGGCPICK
QLIALCCYHAKHCQENKCPVPFCLNIKQKLRQQQLQHRLQQAQMLRRRMASM
Ligands and cofactors
| ID | Name | Formula | Copies |
|---|
| ZN | Zinc ion | Zn | 3 |
Primary citation
Structure of p300 bound to MEF2 on DNA reveals a mechanism of enhanceosome assembly. He, J., Ye, J., Cai, Y. et al. Nucleic Acids Res (2011) 39:4464-4474. DOI 10.1093/nar/gkr030 · PubMed
Other PDB entries of the same protein (UniProt Q02078 (AlphaFold model), which also has an AlphaFold model), best resolution first:
- 1EGW 1.5 Å, Crystal structure of MEF2A core bound to DNA
- 6WC2 2.1 Å, Crystal Structure of a Ternary MEF2 Chimera/NKX2-5/myocardin enhancer DNA Complex
- 1LEW 2.3 Å, Crystal structure of map kinase P38 complexed to the docking site on its nuclear…
- 6BYY 2.3 Å, MEF2 CHIMERA/DNA Complex
- 3MU6 2.43 Å, Inhibiting the Binding of Class IIa Histone Deacetylases to Myocyte Enhancer Factor-2 by…
- 3KOV 2.9 Å, Structure of MEF2A bound to DNA reveals a completely folded MADS-box/MEF2 domain that…
- 6BZ1 2.97 Å, MEF2 Chimera D83V mutant/DNA complex
- 7XUZ 3.59 Å, Crystal structure of a HDAC4-MEF2A-DNA ternary complex
- 1C7U Complex of the DNA binding core domain of the transcription factor MEF2A with a 20mer…
Browse structure collections
About this viewer
MolViewer shows 3P57 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.