3P6Y: CF Im25-CF Im68-UGUAA complex

CF Im25-CF Im68-UGUAA complex. Determined by X-ray diffraction at 2.9 Å resolution. Released 3 Nov 2010.

Method: X-ray diffraction
Resolution: 2.9 Å
Organism: Homo sapiens
Chains: 23
Atoms: 17,567
Mol. weight: 281.11 kDa
Released: 3 Nov 2010

Explore 3P6Y in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

3P6Y contains 87 α-helices and 159 β-strands across 16 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 8 helices, 14 β-strands

Element	Residues	Length	Sheet
β-strand	36-39	4	1
β-strand	41	1	2
α-helix	42-44	3
β-strand	45-50	6	3
α-helix	60-74	15
β-strand	77-84	8	4
β-strand	85-88	4	2
β-strand	91-98	8	2
β-strand	104-105	2	2
β-strand	108-110	3	4
α-helix	111-112	2
α-helix	117-129	13
β-strand	140-150	11	4
β-strand	158	1	4
β-strand	170-178	9	4
α-helix	179-180	2
β-strand	183-188	6	3
β-strand	192-197	6	2
α-helix	198-201	4
α-helix	205-212	8
α-helix	215-219	5
β-strand	223-226	4	1

Chain B: 9 helices, 14 β-strands

Element	Residues	Length	Sheet
β-strand	36-39	4	5
β-strand	41	1	6
α-helix	42-44	3
β-strand	45-50	6	7
α-helix	60-73	14
β-strand	77-84	8	8
β-strand	85-88	4	6
β-strand	91-99	9	6
β-strand	103-105	3	6
β-strand	108-110	3	8
α-helix	111-112	2
α-helix	117-129	13
β-strand	140-150	11	8
β-strand	158	1	8
β-strand	170-178	9	8
β-strand	183-188	6	7
β-strand	192-197	6	6
α-helix	198-201	4
α-helix	205-208	4
α-helix	212-214	3
α-helix	215-219	5
β-strand	223-226	4	5
α-helix	227-229	3

Chain C: 2 helices, 6 β-strands

Element	Residues	Length	Sheet
β-strand	82-86	5	9
α-helix	94-102	9
β-strand	111-116	6	9
β-strand	123-130	8	9
α-helix	134-143	10
β-strand	149	1	10
β-strand	152	1	10
β-strand	155-158	4	9

Chain D: 3 helices, 6 β-strands

Element	Residues	Length	Sheet
β-strand	82-86	5	11
α-helix	94-104	11
β-strand	112-116	5	11
β-strand	123-130	8	11
α-helix	134-143	10
α-helix	144-146	3
β-strand	149	1	12
β-strand	152	1	12
β-strand	155-158	4	11

Chain E: 7 helices, 14 β-strands

Element	Residues	Length	Sheet
β-strand	36-39	4	13
β-strand	41	1	14
α-helix	42-44	3
β-strand	45-50	6	15
α-helix	60-73	14
β-strand	77-84	8	16
β-strand	85-87	3	14
β-strand	92-99	8	14
β-strand	103-105	3	14
β-strand	108-110	3	16
α-helix	111-112	2
α-helix	117-128	12
β-strand	140-150	11	16
β-strand	158	1	16
β-strand	170-178	9	16
β-strand	183-188	6	15
β-strand	192-197	6	14
α-helix	198-201	4
α-helix	205-213	9
α-helix	215-219	5
β-strand	223-226	4	13

Chain F: 9 helices, 14 β-strands

Element	Residues	Length	Sheet
β-strand	36-39	4	17
β-strand	41	1	18
α-helix	42-44	3
β-strand	45-50	6	19
α-helix	60-74	15
β-strand	77-84	8	20
β-strand	85-88	4	18
β-strand	91-99	9	18
β-strand	103-105	3	18
β-strand	108-110	3	20
α-helix	111-112	2
α-helix	117-128	12
β-strand	140-150	11	20
β-strand	158	1	20
β-strand	170-178	9	20
β-strand	183-188	6	19
β-strand	192-197	6	18
α-helix	198-201	4
α-helix	205-208	4
α-helix	212-214	3
α-helix	215-219	5
β-strand	223-226	4	17
α-helix	227-229	3

Chain G: 2 helices, 6 β-strands

Element	Residues	Length	Sheet
β-strand	81-86	6	21
α-helix	94-104	11
β-strand	109-116	8	21
β-strand	123-131	9	21
α-helix	134-142	9
β-strand	149	1	22
β-strand	152	1	22
β-strand	155-157	3	21

Chain H: 4 helices, 6 β-strands

Element	Residues	Length	Sheet
β-strand	84-86	3	23
α-helix	94-101	8
β-strand	111-116	6	23
β-strand	123-130	8	23
α-helix	134-137	4
α-helix	139-143	5
α-helix	144-146	3
β-strand	149	1	24
β-strand	152	1	24
β-strand	155-157	3	23

8 more chain groups are not listed. Open the entry in the viewer and use the sequence panel to see them.

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Cleavage and polyadenylation specificity factor subunit 5	A, B, E, F, I, J, M, N	protein	202	Homo sapiens	O43809 (AlphaFold model)
Cleavage and polyadenylation specificity factor subunit 6	C, D, G, H, K, L, O, P	protein	90	Homo sapiens	Q16630 (AlphaFold model)
5'-r(upgpupap*a)-3'	Q, R, S, T, U, V, W	RNA	5

Sequence of entity 1 (A, B, E, F, I, J, M, N), FASTA

>3P6Y_1 Cleavage and polyadenylation specificity factor subunit 5 (chains A, B, E, F, I, J, M, N)
ERTINLYPLTNYTFGTKEPLYEKDSSVAARFQRMREEFDKIGMRRTVEGVLIVHEHRLPH
VLLLQLGTTFFKLPGGELNPGEDEVEGLKRLMTEILGRQDGVLQDWVIDDCIGNWWRPNF
EPPQYPYIPAHITKPKEHKKLFLVQLQEKALFAVPKNYKLVAAPLFELYDNAPGYGPIIS
SLPQLLSRFNFIYNLEHHHHHH

Sequence of entity 2 (C, D, G, H, K, L, O, P), FASTA

>3P6Y_2 Cleavage and polyadenylation specificity factor subunit 6 (chains C, D, G, H, K, L, O, P)
RIALYIGNLTWWTTDEDLTEAVHSLGVNDILEIKFFENRANGQSKGFALVGVGSEASSKK
LMDLLPKRELHGQNPVVTPSNKLEHHHHHH

Sequence of entity 3 (Q, R, S, T, U, V, W), FASTA

>3P6Y_3 5'-R(*UP*GP*UP*AP*A)-3' (chains Q, R, S, T, U, V, W)
UGUAA

Primary citation

Structural basis of pre-mRNA recognition by the human cleavage factor Im complex. Li, H., Tong, S., Li, X. et al. To be published.

Other PDB entries of the same protein (UniProt O43809 (AlphaFold model), which also has an AlphaFold model), best resolution first:

5R4Q 1.49 Å, PanDDA analysis group deposition -- Crystal Structure of HUMAN CLEAVAGE FACTOR IM in…
5R4R 1.5 Å, PanDDA analysis group deposition -- Crystal Structure of HUMAN CLEAVAGE FACTOR IM in…
5R67 1.52 Å, PanDDA analysis group deposition -- Crystal Structure of HUMAN CLEAVAGE FACTOR IM in…
5R4S 1.61 Å, PanDDA analysis group deposition -- Crystal Structure of HUMAN CLEAVAGE FACTOR IM in…
5R4T 1.68 Å, PanDDA analysis group deposition -- Crystal Structure of HUMAN CLEAVAGE FACTOR IM in…
5R4P 1.78 Å, PanDDA analysis group deposition -- Crystal Structure of HUMAN CLEAVAGE FACTOR IM in…
3BHO 1.8 Å, Crystal Structure of the 25kDa Subunit of Human Cleavage factor Im with Ap4A
5R64 1.84 Å, PanDDA analysis group deposition -- Crystal Structure of HUMAN CLEAVAGE FACTOR IM in…
3BAP 1.85 Å, Crystal Structure of the 25 kDa Subunit of Human Cleavage Factor Im
2CL3 1.9 Å, Crystal structure of human Cleavage and Polyadenylation Specificity Factor 5 (CPSF5)
3N9U 1.92 Å, Crystal Structure of the Complex between the 25 kDa Subunit and the 59 kDa Subunit (RRM…
5R4U 1.92 Å, PanDDA analysis group deposition -- Crystal Structure of HUMAN CLEAVAGE FACTOR IM in…

Browse structure collections

About this viewer

MolViewer shows 3P6Y directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.