Crystal structure of the TSG101 UEV domain in complex with FA258 peptide. Determined by X-ray diffraction at 1.8 Å resolution. Released 29 Jun 2011.
Explore 3P9H in 3D Show helices and sheets RCSB PDB PDBe
3P9H contains 7 α-helices and 11 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 5-11 | 7 | |
| α-helix | 18-31 | 14 | |
| β-strand | 35-42 | 8 | 1 |
| β-strand | 50-63 | 14 | 1 |
| β-strand | 66-76 | 11 | 1 |
| α-helix | 84-85 | 2 | |
| β-strand | 86-89 | 4 | 1 |
| β-strand | 95-97 | 3 | 2 |
| β-strand | 100 | 1 | 3 |
| β-strand | 103 | 1 | 3 |
| β-strand | 108 | 1 | 1 |
| β-strand | 109 | 1 | 3 |
| α-helix | 112-115 | 4 | |
| α-helix | 124-137 | 14 | |
| β-strand | 141-143 | 3 | 2 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 6 | 1 | |
| β-strand | 7 | 1 | 2 |
| α-helix | 8 | 1 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Tumor susceptibility gene 101 protein | A | protein | 145 | Homo sapiens | Q99816 (AlphaFold model) |
| Gag polyprotein | B | protein | 11 | Q9YP46 |
>3P9H_1 Tumor susceptibility gene 101 protein (chains A) GAMGSAVSESQLKKMVSKYKYRDLTVRETVNVITLYKDLKPVLDSYGGSRELMNLTGTIP VPYRGNTYNIPICLWLLDTYPYNPPICFVKPTSSMTIKTGKHVDANGKIYLPYLHEWKHP QSDLLGLIQVMIVVFGDEPPVFSRP
>3P9H_2 Gag polyprotein (chains B) XPEXTAPPEEX
Elucidation of New Binding Interactions with the Tumor Susceptibility Gene 101 (Tsg101) Protein Using Modified HIV-1 Gag-p6 Derived Peptide Ligands. Kim, S.E., Liu, F., Im, Y.J. et al. ACS Med Chem Lett (2011) 2:337-341. DOI 10.1021/ml1002579 · PubMed
Other PDB entries of the same protein (UniProt Q99816 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 3P9H directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.