7NLC: Tsg101 UEV domain

Crystallographic structure of human Tsg101 UEV domain in complex with a HEV ORF3 peptide. Determined by X-ray diffraction at 1.4 Å resolution. Released 2 Mar 2022.

Method: X-ray diffraction
Resolution: 1.4 Å
Organisms: Homo sapiens, Hepatitis E virus
Chains: 2
Atoms: 1,411
Mol. weight: 18.79 kDa
Released: 2 Mar 2022

Explore 7NLC in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

7NLC contains 9 α-helices and 11 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 7 helices, 10 β-strands

Element	Residues	Length	Sheet
α-helix	7-13	7
α-helix	20-31	12
β-strand	37-45	9	1
α-helix	46	1
β-strand	51-65	15	1
β-strand	68-78	11	1
α-helix	79	1
α-helix	86-87	2
β-strand	88-91	4	1
β-strand	97-99	3	2
β-strand	102	1	3
β-strand	105	1	3
β-strand	110	1	1
β-strand	111	1	3
α-helix	114-117	4
α-helix	126-139	14
β-strand	143-145	3	2

Chain B: 2 helices, 1 β-strand

Element	Residues	Length	Sheet
α-helix	6	1
β-strand	7	1	2
α-helix	8-9	2

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Tsg101 UEV domain	A	protein	147	Homo sapiens	Q99816 (AlphaFold model)
Protein ORF3	B	protein	10	Hepatitis E virus	Q9YLR0

Sequence of entity 1 (A), FASTA

>7NLC_1 Tsg101 UEV domain (chains A)
GAMAVSESQLKKMVSKYKYRDLTVRETVNVITLYKDLKPVLDSYVFNDGSSRELMNLTGT
IPVPYRGNTYNIPICLWLLDTYPYNPPICFVKPTSSMTIKTGKHVDANGKIYLPYLHEWK
HPQSDLLGLIQVMIVVFGDEPPVFSRP

Sequence of entity 2 (B), FASTA

>7NLC_2 Protein ORF3 (chains B)
TSPSAPPLPP

Primary citation

Crystallographic structure of human Tsg101 UEV domain in complex with a HEV ORF3 peptide. Moschidi, D., Dupre, E., Villeret, V. et al. To be published.

Other PDB entries of the same protein (UniProt Q99816 (AlphaFold model), which also has an AlphaFold model), best resolution first:

3OBQ 1.4 Å, Crystal Structure of the Tsg101 UEV domain in complex with a human HRS PSAP peptide
3OBS 1.5 Å, Crystal structure of Tsg101 UEV domain
3OBU 1.6 Å, Crystal structure of the Tsg101 UEV domain in complex with a HIV-1 PTAP peptide
3OBX 1.6 Å, Crystal structure of the Tsg101 UEV domain in complex with a HIV-1 Gag P7A mutant peptide
3P9G 1.8 Å, Crystal structure of the TSG101 UEV domain in complex with FA459 peptide
3P9H 1.8 Å, Crystal structure of the TSG101 UEV domain in complex with FA258 peptide
1S1Q 2.0 Å, TSG101(UEV) domain in complex with Ubiquitin
4YC1 2.0 Å, Structure of the human TSG101-UEV domain in the P321 space group
6VME 2.19 Å, Human ESCRT-I heterotetramer headpiece
4EJE 2.2 Å, Structure Of The Tsg101 UEV Domain In Complex With an Ebola PTAP late Domain Peptide
7ZLX 2.25 Å, Crystal Structure of the TSG101-UEV domain:space group P21
2F0R 2.26 Å, Crystallographic structure of human Tsg101 UEV domain

Browse structure collections

About this viewer

MolViewer shows 7NLC directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.