7ZLX: TSG101-UEV domain:space group P21

Crystal Structure of the TSG101-UEV domain:space group P21. Determined by X-ray diffraction at 2.25 Å resolution. Released 22 Jun 2022.

Method: X-ray diffraction
Resolution: 2.25 Å
Organism: Homo sapiens
Chains: 12
Atoms: 13,428
Mol. weight: 219.85 kDa
Released: 22 Jun 2022

Explore 7ZLX in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

7ZLX contains 73 α-helices and 128 β-strands across 12 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chains A, C and I: 6 helices, 11 β-strands

Element	Residues	Length	Sheet
α-helix	5-11	7
α-helix	18-31	14
β-strand	35-43	9	1
β-strand	49-63	15	1
β-strand	66-75	10	1
α-helix	76-77	2
α-helix	84-85	2
β-strand	86-89	4	1
β-strand	96-97	2	2
β-strand	100	1	3
β-strand	103	1	3
β-strand	108	1	1
β-strand	109	1	3
α-helix	112-115	4
α-helix	124-137	14
β-strand	141-142	2	2
β-strand	144	1	4

Chains B and D: 6 helices, 10 β-strands

Element	Residues	Length	Sheet
α-helix	5-11	7
α-helix	18-31	14
β-strand	35-43	9	5
β-strand	49-63	15	5
β-strand	66-75	10	5
α-helix	76-77	2
α-helix	84-85	2
β-strand	86-89	4	5
β-strand	96-97	2	6
β-strand	100	1	7
β-strand	103	1	7
β-strand	108	1	5
β-strand	109	1	7
α-helix	112-115	4
α-helix	124-137	14
β-strand	141-142	2	6

Chain E: 6 helices, 11 β-strands

Element	Residues	Length	Sheet
α-helix	5-11	7
α-helix	18-29	12
β-strand	35-43	9	15
β-strand	49-63	15	15
β-strand	66-75	10	15
α-helix	76-77	2
α-helix	84-85	2
β-strand	86-89	4	15
β-strand	96-97	2	16
β-strand	100	1	17
β-strand	103	1	17
β-strand	108	1	15
β-strand	109	1	17
α-helix	112-115	4
α-helix	124-137	14
β-strand	141-142	2	16
β-strand	144	1	11

Chain F: 7 helices, 10 β-strands

Element	Residues	Length	Sheet
α-helix	2-4	3
α-helix	5-11	7
α-helix	18-31	14
β-strand	35-43	9	18
β-strand	49-63	15	18
β-strand	66-75	10	18
α-helix	76-77	2
α-helix	84-85	2
β-strand	86-89	4	18
β-strand	96-97	2	19
β-strand	100	1	20
β-strand	103	1	20
β-strand	108	1	18
β-strand	109	1	20
α-helix	112-115	4
α-helix	124-137	14
β-strand	141-142	2	19

Chain G: 6 helices, 11 β-strands

Element	Residues	Length	Sheet
α-helix	8-11	4
α-helix	18-31	14
β-strand	35-43	9	21
β-strand	49-63	15	21
β-strand	66-76	11	21
α-helix	77	1
α-helix	84-85	2
β-strand	86-89	4	21
β-strand	96-97	2	22
β-strand	100	1	23
β-strand	103	1	23
β-strand	108	1	21
β-strand	109	1	23
α-helix	112-115	4
α-helix	124-137	14
β-strand	141-142	2	22
β-strand	144	1	24

Chain H: 5 helices, 11 β-strands

Element	Residues	Length	Sheet
α-helix	5-11	7
α-helix	18-31	14
β-strand	35-42	8	25
β-strand	50-63	14	25
β-strand	66-75	10	25
α-helix	84-85	2
β-strand	86-89	4	25
β-strand	96-97	2	26
β-strand	100	1	27
β-strand	103	1	27
β-strand	108	1	25
β-strand	109	1	27
α-helix	112-115	4
α-helix	124-137	14
β-strand	141-142	2	26
β-strand	144	1	28

Chain J: 7 helices, 11 β-strands

Element	Residues	Length	Sheet
α-helix	2-4	3
α-helix	5-11	7
α-helix	18-31	14
β-strand	35-41	7	32
β-strand	51-63	13	32
β-strand	66-75	10	32
α-helix	76-77	2
α-helix	84-85	2
β-strand	86-89	4	32
β-strand	96-97	2	33
β-strand	100	1	34
β-strand	103	1	34
β-strand	108	1	32
β-strand	109	1	34
α-helix	112-115	4
α-helix	124-137	14
β-strand	141-142	2	33
β-strand	144	1	28

Chain K: 6 helices, 10 β-strands

Element	Residues	Length	Sheet
α-helix	8-11	4
α-helix	18-31	14
β-strand	35-42	8	35
β-strand	50-63	14	35
β-strand	66-75	10	35
α-helix	76-77	2
α-helix	84-85	2
β-strand	86-89	4	35
β-strand	96-97	2	36
β-strand	100	1	37
β-strand	103	1	37
β-strand	108	1	35
β-strand	109	1	37
α-helix	112-115	4
α-helix	124-137	14
β-strand	141-142	2	36

1 more chain groups are not listed. Open the entry in the viewer and use the sequence panel to see them.

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Tumor susceptibility gene 101 protein	A, B, C, D, E, F, G, H, I, J, K, L	protein	159	Homo sapiens	Q99816 (AlphaFold model)

Sequence of entity 1 (A, B, C, D, E, F, G, H, I, J, K, L), FASTA

>7ZLX_1 Tumor susceptibility gene 101 protein (chains A, B, C, D, E, F, G, H, I, J, K, L)
MRGSHHHHHHGMASMAVSESQLKKMVSKYKYRDLTVRETVNVITLYKDLKPVLDSYVFND
GSSRELMNLTGTIPVPYRGNTYNIPICLWLLDTYPYNPPICFVKPTSSMTIKTGKHVDAN
GKIYLPYLHEWKHPQSDLLGLIQVMIVVFGDEPPVFSRP

Primary citation

Crystal Structure of the TSG101-UEV domain:space group P21. Camara-Artigas, A. To be published.

Other PDB entries of the same protein (UniProt Q99816 (AlphaFold model), which also has an AlphaFold model), best resolution first:

7NLC 1.4 Å, Crystallographic structure of human Tsg101 UEV domain in complex with a HEV ORF3 peptide
3OBQ 1.4 Å, Crystal Structure of the Tsg101 UEV domain in complex with a human HRS PSAP peptide
3OBS 1.5 Å, Crystal structure of Tsg101 UEV domain
3OBU 1.6 Å, Crystal structure of the Tsg101 UEV domain in complex with a HIV-1 PTAP peptide
3OBX 1.6 Å, Crystal structure of the Tsg101 UEV domain in complex with a HIV-1 Gag P7A mutant peptide
3P9G 1.8 Å, Crystal structure of the TSG101 UEV domain in complex with FA459 peptide
3P9H 1.8 Å, Crystal structure of the TSG101 UEV domain in complex with FA258 peptide
1S1Q 2.0 Å, TSG101(UEV) domain in complex with Ubiquitin
4YC1 2.0 Å, Structure of the human TSG101-UEV domain in the P321 space group
6VME 2.19 Å, Human ESCRT-I heterotetramer headpiece
4EJE 2.2 Å, Structure Of The Tsg101 UEV Domain In Complex With an Ebola PTAP late Domain Peptide
2F0R 2.26 Å, Crystallographic structure of human Tsg101 UEV domain

Browse structure collections

About this viewer

MolViewer shows 7ZLX directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.