3P9H: TSG101 UEV domain

Crystal structure of the TSG101 UEV domain in complex with FA258 peptide. Determined by X-ray diffraction at 1.8 Å resolution. Released 29 Jun 2011.

Method: X-ray diffraction
Resolution: 1.8 Å
Organism: Homo sapiens
Chains: 2
Atoms: 1,339
Mol. weight: 17.57 kDa
Released: 29 Jun 2011

Explore 3P9H in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

3P9H contains 7 α-helices and 11 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 5 helices, 10 β-strands

Element	Residues	Length	Sheet
α-helix	5-11	7
α-helix	18-31	14
β-strand	35-42	8	1
β-strand	50-63	14	1
β-strand	66-76	11	1
α-helix	84-85	2
β-strand	86-89	4	1
β-strand	95-97	3	2
β-strand	100	1	3
β-strand	103	1	3
β-strand	108	1	1
β-strand	109	1	3
α-helix	112-115	4
α-helix	124-137	14
β-strand	141-143	3	2

Chain B: 2 helices, 1 β-strand

Element	Residues	Length	Sheet
α-helix	6	1
β-strand	7	1	2
α-helix	8	1

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Tumor susceptibility gene 101 protein	A	protein	145	Homo sapiens	Q99816 (AlphaFold model)
Gag polyprotein	B	protein	11		Q9YP46

Sequence of entity 1 (A), FASTA

>3P9H_1 Tumor susceptibility gene 101 protein (chains A)
GAMGSAVSESQLKKMVSKYKYRDLTVRETVNVITLYKDLKPVLDSYGGSRELMNLTGTIP
VPYRGNTYNIPICLWLLDTYPYNPPICFVKPTSSMTIKTGKHVDANGKIYLPYLHEWKHP
QSDLLGLIQVMIVVFGDEPPVFSRP

Sequence of entity 2 (B), FASTA

>3P9H_2 Gag polyprotein (chains B)
XPEXTAPPEEX

Primary citation

Elucidation of New Binding Interactions with the Tumor Susceptibility Gene 101 (Tsg101) Protein Using Modified HIV-1 Gag-p6 Derived Peptide Ligands. Kim, S.E., Liu, F., Im, Y.J. et al. ACS Med Chem Lett (2011) 2:337-341. DOI 10.1021/ml1002579 · PubMed

Other PDB entries of the same protein (UniProt Q99816 (AlphaFold model), which also has an AlphaFold model), best resolution first:

7NLC 1.4 Å, Crystallographic structure of human Tsg101 UEV domain in complex with a HEV ORF3 peptide
3OBQ 1.4 Å, Crystal Structure of the Tsg101 UEV domain in complex with a human HRS PSAP peptide
3OBS 1.5 Å, Crystal structure of Tsg101 UEV domain
3OBU 1.6 Å, Crystal structure of the Tsg101 UEV domain in complex with a HIV-1 PTAP peptide
3OBX 1.6 Å, Crystal structure of the Tsg101 UEV domain in complex with a HIV-1 Gag P7A mutant peptide
3P9G 1.8 Å, Crystal structure of the TSG101 UEV domain in complex with FA459 peptide
1S1Q 2.0 Å, TSG101(UEV) domain in complex with Ubiquitin
4YC1 2.0 Å, Structure of the human TSG101-UEV domain in the P321 space group
6VME 2.19 Å, Human ESCRT-I heterotetramer headpiece
4EJE 2.2 Å, Structure Of The Tsg101 UEV Domain In Complex With an Ebola PTAP late Domain Peptide
7ZLX 2.25 Å, Crystal Structure of the TSG101-UEV domain:space group P21
2F0R 2.26 Å, Crystallographic structure of human Tsg101 UEV domain

Browse structure collections

About this viewer

MolViewer shows 3P9H directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.