3PBL: Human dopamine D3 receptor

Structure of the human dopamine D3 receptor in complex with eticlopride. Determined by X-ray diffraction at 2.89 Å resolution. Released 3 Nov 2010.

Method: X-ray diffraction
Resolution: 2.89 Å
Organisms: Homo sapiens, Enterobacteria phage T4
Chains: 2
Atoms: 6,787
Mol. weight: 108.67 kDa
Ligands: ETQ
Released: 3 Nov 2010

Explore 3PBL in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

3PBL contains 47 α-helices and 8 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 23 helices, 3 β-strands

Element	Residues	Length	Sheet
α-helix	35-56	22
α-helix	63-77	15
α-helix	78-82	5
α-helix	83-91	9
α-helix	100-133	34
α-helix	135-140	6
α-helix	147-167	21
α-helix	168-172	5
α-helix	186-192	7
α-helix	193-198	6
α-helix	199-216	18
α-helix	1003-1011	9
β-strand	1018-1019	2	1
β-strand	1025-1027	3	1
β-strand	1031-1034	4	1
α-helix	1039-1050	12
α-helix	1060-1080	21
α-helix	1085-1089	5
α-helix	1093-1111	19
α-helix	1115-1122	8
α-helix	1126-1134	9
α-helix	1137-1141	5
α-helix	1143-1155	13
α-helix	322-353	32
α-helix	362-386	25
α-helix	388-398	11

Chain B: 24 helices, 5 β-strands

Element	Residues	Length	Sheet
α-helix	35-54	20
α-helix	58-60	3
α-helix	65-77	13
α-helix	78-82	5
α-helix	83-91	9
β-strand	95	1	2
α-helix	100-133	34
α-helix	146-165	20
α-helix	166-170	5
β-strand	180	1	2
α-helix	186-192	7
α-helix	193-198	6
α-helix	199-218	20
α-helix	1003-1011	9
β-strand	1014-1019	6	3
β-strand	1025-1028	4	3
β-strand	1031-1034	4	3
α-helix	1039-1050	12
α-helix	1060-1080	21
α-helix	1085-1090	6
α-helix	1093-1106	14
α-helix	1108-1111	4
α-helix	1115-1122	8
α-helix	1126-1132	7
α-helix	1137-1141	5
α-helix	1143-1155	13
α-helix	322-354	33
α-helix	362-386	25
α-helix	388-397	10

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
D(3) dopamine receptor, Lysozyme chimera	A, B	protein	481	Homo sapiens, Enterobacteria phage T4	P00720, P35462 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>3PBL_1 D(3) dopamine receptor, Lysozyme chimera (chains A, B)
DYKDDDDGAPASLSQLSSHLNYTCGAENSTGASQARPHAYYALSYCALILAIVFGNGLVC
MAVLKERALQTTTNYLVVSLAVADLLVATLVMPWVVYLEVTGGVWNFSRICCDVFVTLDV
MMCTASIWNLCAISIDRYTAVVMPVHYQHGTGQSSCRRVALMITAVWVLAFAVSCPLLFG
FNTTGDPTVCSISNPDFVIYSSVVSFYLPFGVTVLVYARIYVVLKQRRRKNIFEMLRIDE
GLRLKIYKDTEGYYTIGIGHLLTKSPSLNAAKSELDKAIGRNTNGVITKDEAEKLFNQDV
DAAVRGILRNAKLKPVYDSLDAVRRAALINMVFQMGETGVAGFTNSLRMLQQKRWDEAAV
NLAKSRWYNQTPNRAKRVITTFRTGTWDAYGVPLREKKATQMVAIVLGAFIVCWLPFFLT
HVLNTHCQTCHVSPELYSATTWLGYVNSALNPVIYTTFNIEFRKAFLKILSCGRPLEVLF
Q

Ligands and cofactors

ID	Name	Formula	Copies
ETQ	3-chloro-5-ethyl-N-{[(2S)-1-ethylpyrrolidin-2-yl]methyl}-6-hydroxy-2-methoxyben…	C17 H25 Cl N2 O3	2

Primary citation

Structure of the human dopamine d3 receptor in complex with a d2/d3 selective antagonist. Chien, E.Y., Liu, W., Zhao, Q. et al. Science (2010) 330:1091-1095. DOI 10.1126/science.1197410 · PubMed

Other PDB entries of the same protein (UniProt P00720), best resolution first:

2O7A 0.84 Å, T4 lysozyme C-terminal fragment
5JDT 1.0 Å, Structure of Spin-labelled T4 lysozyme mutant L118C-R1 at 100K
7LOE 1.01 Å, T4 lysozyme mutant L99A in complex with 1-fluoranylnaphthalene
7LOD 1.02 Å, T4 lysozyme mutant L99A in complex with 1-fluoranyl-4-iodanyl-benzene
7LX8 1.03 Å, T4 lysozyme mutant L99A
5XPF 1.04 Å, High-resolution X-ray structure of the T26H mutant of T4 lysozyme
6BG3 1.05 Å, Structure of (3S,4S)-1-benzyl-4-(3-(3-(trifluoromethyl)phenyl)ureido)piperidin-3-yl…
7LOF 1.05 Å, T4 lysozyme mutant L99A in complex with 2-butylthiophene
7LX6 1.05 Å, T4 lysozyme mutant L99A
7LX7 1.05 Å, T4 lysozyme mutant L99A
1SWY 1.06 Å, Use of a Halide Binding Site to Bypass the 1000-atom Limit to Ab initio Structure…
1SWZ 1.06 Å, Use of an ion-binding site to bypass the 1000-atom limit to ab initio structure…

Browse more

3PBL is part of these collections:

GPCRs and cell signaling

About this viewer

MolViewer shows 3PBL directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.